SecReT6
Protein ID: 549688962
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1427
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1524204..1525592 [+]
Productputative Type VI secretion system, FHA domain-containing
NoteFha
UniProt IDU4K4G8
KEGG IDvni:VIBNI_A1427
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.00E-14, Aligned region: 32..101
DUF605 [PF04652], Evalue: 0.0031, Aligned region: 108..263
Protein Sequence: 462 a.a.     [Download]
>gi|549688962|ref|YP_008620694.1| putative Type VI secretion system, FHA domain-containing [Vibrio nigripulchritudo]
MGIVLSINSFHKFTSEIQSEFEFNDNNVNDSVKFGRSDSCDWTLPDPERVVSSVHGELIRFGGDYLIRDL
STNGLFLNRSVTPVGNGNEIKLNDNDIITFGEYEILVELKNSGETTIHPHQEVNASDVFNQIPNDDFNAP
TGFNNHTQDHNFASDLSSNLQNNPVFESDIGLTDDFFNLQETHVTDDLVADTPPQPAQPQVAPDFIPEPP
PQQHVQPQAHNEPAQAAVATPRVERPSPGRAAPQTQTEKPQVNQPSQAPQAAKPHVAGGTSGEMDAFLSG
LGITRNMVPAQHSEEWFKQLGESFALLLGGLMDTLHHRAEFKQTNRLNHTAFQRHENNPLKFSANLEDAI
HNLYNRNTASFLAPQHAIQEAFDDIEKHEKALMLGVDGAVRGVMGLLNPDYISTMNASDGVLEKIIPGKT
QANFWKNYERQYSDLSNELEESSTPFYLEDFAKSYEMALKKG
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1524204-1525592 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGGGAATCGTGCTGTCTATTAACAGCTTTCATAAATTTACATCTGAGATTCAGAGTGAGTTTGAATTTA
ATGATAATAATGTAAATGATTCAGTTAAATTCGGTCGCTCAGATAGCTGTGACTGGACATTGCCTGATCC
AGAACGAGTTGTATCAAGTGTTCATGGTGAACTTATTCGCTTTGGTGGTGATTATTTAATAAGAGATTTA
TCAACAAATGGATTATTCTTAAATAGGTCGGTAACGCCTGTTGGTAATGGCAATGAAATTAAGCTTAATG
ATAATGATATAATTACATTTGGTGAGTACGAAATTCTGGTGGAGTTAAAGAACTCTGGTGAAACGACCAT
TCACCCTCATCAGGAAGTCAACGCAAGTGACGTATTTAATCAAATTCCCAACGATGATTTTAATGCGCCA
ACTGGGTTTAATAATCACACCCAAGACCACAATTTTGCCAGCGACTTATCTTCGAATTTGCAGAACAATC
CTGTGTTCGAAAGCGATATCGGGCTAACTGACGATTTCTTTAACTTGCAAGAAACACATGTTACAGACGA
TCTGGTAGCAGATACTCCTCCTCAACCCGCACAGCCACAGGTTGCGCCAGATTTTATTCCTGAGCCACCT
CCTCAGCAACACGTACAGCCACAAGCACACAATGAACCTGCTCAGGCAGCGGTTGCAACACCAAGAGTAG
AACGCCCATCGCCGGGCAGAGCGGCTCCTCAAACTCAGACAGAAAAACCGCAAGTAAATCAACCGAGTCA
AGCACCTCAAGCGGCGAAACCTCATGTGGCAGGTGGCACTTCAGGAGAAATGGATGCGTTTCTGAGTGGT
TTGGGGATCACACGAAATATGGTCCCAGCCCAACACTCCGAAGAGTGGTTTAAGCAACTCGGTGAATCAT
TTGCGCTGTTGCTAGGTGGATTGATGGATACACTTCATCACAGAGCAGAATTTAAACAGACAAATCGCTT
GAATCACACCGCATTCCAAAGGCATGAAAATAACCCACTTAAATTTTCTGCAAACCTGGAAGACGCGATC
CACAACCTCTACAACCGTAATACTGCGAGTTTTTTAGCACCACAGCACGCTATTCAAGAAGCTTTTGATG
ACATTGAAAAACACGAAAAAGCGTTAATGCTGGGTGTAGATGGCGCGGTACGTGGTGTTATGGGATTACT
GAATCCAGATTATATTTCCACCATGAATGCGAGTGACGGTGTACTAGAGAAAATAATACCGGGTAAAACC
CAGGCTAATTTTTGGAAAAACTACGAGAGACAATATTCAGATTTGTCCAATGAACTTGAAGAGAGTTCCA
CTCCATTCTATTTAGAAGACTTCGCTAAATCTTACGAAATGGCTTTGAAAAAAGGTTGA
 Primer design