SecReT6
Protein ID: 549688963
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1428
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1525597..1526058 [+]
Productputative Type VI secretion system, lipoprotein VCA0113
NoteTssJ
UniProt IDU4JXA5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-38, Aligned region: 15..148
Protein Sequence: 153 a.a.     [Download]
>gi|549688963|ref|YP_008620695.1| putative Type VI secretion system, lipoprotein VCA0113 [Vibrio nigripulchritudo]
MKQKTKLSIMGLLFALVLAGCSVANYVVPAYSTLEFEVSNKANPDLNGRPSPVVIHVYELTSNTLFESQD
FFSLYEEPEEVLGPDLIAKQEFTFAPGSTELYEVSMKPEVEYVGVIAAYRDIENANWRKVIPVDKTGYEK
HKLLIGELSIAVK
 
Nucleotide Sequence: 462 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1525597-1526058 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGAAACAAAAAACAAAATTATCAATAATGGGGCTATTATTTGCACTCGTTCTAGCAGGATGCTCAGTAG
CTAACTATGTTGTACCAGCGTATTCAACACTTGAATTTGAGGTTAGCAACAAGGCAAACCCAGATTTAAA
TGGTCGACCTTCTCCCGTAGTCATTCACGTTTACGAATTAACGTCAAATACGTTATTTGAAAGCCAAGAT
TTCTTTTCTCTATATGAAGAACCTGAAGAAGTTTTAGGTCCTGATCTAATTGCTAAGCAAGAATTTACTT
TTGCTCCCGGTAGCACTGAGCTATATGAAGTAAGCATGAAGCCTGAAGTGGAATACGTCGGTGTTATTGC
AGCTTACAGAGATATTGAAAATGCAAACTGGCGAAAAGTAATTCCAGTAGACAAAACGGGTTATGAAAAA
CACAAGTTACTTATTGGTGAATTGTCCATAGCTGTTAAATAA
 Primer design