SecReT6
Protein ID: 549688964
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1429
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1526088..1527413 [+]
Producthypothetical protein
NoteTssK
UniProt IDU4K4P3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-143, Aligned region: 19..439
Protein Sequence: 441 a.a.     [Download]
>gi|549688964|ref|YP_008620696.1| conserved hypothetical protein [Vibrio nigripulchritudo]
MSDFSPIAWCEGMFLRPQHFQQQERAINFESKEIQQLLSPYSWGVSLIKFNQALLKEGQLHLEQCQAIMP
DMTLVNVPVKDNAPKPLMVDSETKDTYISLAIPADKVNGQNIASDSEELVTRYIYSDQSVTDNVTGHDEE
ILQLASLRVQLKVTNDKLPGYHSIRVAKIKEVTTEGEVLLDQDFIPPSLNANKNETIHKYLNNIVAMIKI
RADALAQRLGQGKSASASAVDFVMLQMLNRHETTLRHFSQCSDLHPFQLTTALYGLIGELATFSTKSKRP
PVLPKYKHGDMAELFHVVHQMLSQYLSVVLEQTATKLPLEIRQYGIRVSSIPDKNILSKCQFVLAIKADV
ASEELRKRLPSQIKIGPVENIRDLINNQLHGIAISPLTVVPRQIPYQAGYQYFEVTKKGPYWQRLTESGG
LAIHISGNYPGIDVELWTINQ
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1526088-1527413 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGAGTGATTTTTCTCCCATCGCATGGTGTGAGGGTATGTTTTTGCGCCCTCAACATTTTCAGCAGCAAG
AGCGAGCGATTAATTTTGAATCCAAGGAAATCCAGCAATTGCTGTCGCCGTATTCCTGGGGTGTTTCTTT
AATTAAGTTTAACCAGGCGCTGCTTAAAGAAGGTCAACTTCATCTAGAGCAATGTCAGGCAATCATGCCC
GATATGACCTTGGTTAATGTACCGGTTAAAGACAATGCGCCGAAACCTTTAATGGTGGATTCAGAAACCA
AAGACACCTACATTTCCCTCGCTATTCCCGCTGACAAGGTGAATGGTCAGAACATCGCATCCGACTCAGA
AGAGTTGGTTACTCGCTATATATATTCTGATCAATCTGTCACGGACAATGTCACCGGACACGACGAAGAA
ATCCTTCAGCTTGCATCCTTGCGAGTTCAGTTGAAAGTCACCAATGACAAACTTCCTGGTTACCATTCCA
TTAGAGTTGCCAAAATTAAGGAAGTCACGACGGAAGGAGAAGTTCTGCTTGATCAGGACTTCATCCCACC
TTCGTTAAATGCGAACAAGAACGAAACCATTCATAAGTATCTCAACAACATTGTTGCAATGATTAAAATC
CGTGCCGATGCTCTTGCTCAAAGATTAGGGCAGGGGAAGTCGGCATCAGCATCTGCTGTTGATTTTGTCA
TGCTTCAAATGCTCAACCGTCATGAGACAACTTTAAGGCATTTTAGCCAGTGTTCGGATTTACATCCCTT
CCAGTTGACAACGGCACTGTACGGTTTGATCGGAGAGCTAGCGACTTTCTCGACTAAGTCTAAGCGTCCG
CCTGTGTTACCGAAATACAAACATGGTGACATGGCAGAACTTTTCCATGTAGTACATCAGATGCTCAGTC
AGTATCTGAGTGTAGTACTTGAGCAAACGGCGACTAAGCTACCACTTGAGATCAGACAATACGGTATCCG
TGTTTCCAGTATTCCCGACAAAAACATTCTTTCGAAGTGTCAGTTTGTTCTTGCCATCAAAGCTGACGTG
GCAAGTGAAGAGCTGCGTAAACGCTTACCGTCTCAAATCAAGATCGGACCTGTCGAAAACATTCGCGATC
TCATCAACAACCAGCTTCACGGTATCGCAATCTCGCCGCTGACTGTGGTTCCAAGACAAATTCCGTATCA
GGCAGGTTACCAATACTTTGAAGTAACCAAGAAAGGTCCTTACTGGCAAAGACTGACTGAAAGTGGTGGT
TTGGCAATTCATATCTCAGGTAACTACCCGGGGATCGATGTCGAGTTATGGACGATTAATCAATAA
 Primer design