SecReT6
Protein ID: 549688965
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1430
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1527428..1528762 [+]
Productputative Type IV / VI secretion system, DotU fused with Type VI secretion system, OmpA/MotB
NoteTssL
UniProt IDU4KB61
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.10E-60, Aligned region: 56..260
OmpA [PF00691], Evalue: 4.30E-16, Aligned region: 328..426
Protein Sequence: 444 a.a.     [Download]
>gi|549688965|ref|YP_008620697.1| putative Type IV / VI secretion system, DotU fused with Type VI secretion system, OmpA/MotB [Vibrio nigripulchritudo]
MEDTVMKPTPGRRGGAKPAPAAPASPPPPQEGDSTVLLTKVIKEEKSSSVIAFGKNLLLAEANVVLSLIG
QIRATSQYGDVQQLREAFVQKIRDYETRLRLQNARNQDIDIARFCLCCLIDETVLNTVWGGQSIWVDNSL
LSTFYANTQGGEQFYDYLDKAMSAPTESLDILQLQYICMSLGFIGRYRLEKNGVESHRSLRQRVFDVITT
VSERPPKVLSDGWQDKVRVGEEITESTPVWVTLSIAGAILAATYMGFNYKINEESNRTFTNLLNLVPSVE
ITESAPLADVAPVALRIQDYLATEMDRGVVEIQQLPDRVRISFAANELFDSGSAELTQHIRPVLSKVGRS
LEGTKGRIMIVGHTDNKPIFTSKFPSNWHLSLARATSVTNHLADSSNLTGRLIPEGMGDARPLVDNDTEA
NRAKNRRVEIDLLVAQRAVGGEEQ
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1527428-1528762 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGGAAGACACTGTAATGAAACCTACTCCCGGACGTAGAGGTGGTGCTAAGCCAGCACCAGCAGCTCCCG
CTTCTCCACCACCACCCCAAGAGGGAGACAGCACTGTACTGCTTACCAAAGTAATCAAAGAGGAGAAATC
CTCCAGTGTGATCGCGTTTGGAAAAAACTTGCTTCTGGCCGAAGCAAACGTCGTTCTCTCATTGATTGGT
CAAATCAGAGCTACTAGCCAGTACGGTGATGTTCAACAGCTGCGAGAAGCTTTTGTCCAGAAAATTCGAG
ATTACGAAACCCGCTTAAGACTGCAAAACGCAAGAAACCAGGATATTGATATCGCACGTTTCTGCCTATG
CTGTCTAATCGATGAAACCGTGCTGAACACAGTCTGGGGTGGTCAGTCAATTTGGGTAGACAACTCTCTA
CTTTCAACTTTCTACGCCAATACTCAGGGCGGTGAGCAGTTTTATGATTACCTGGACAAAGCCATGTCCG
CGCCAACTGAAAGCCTTGATATTCTGCAACTTCAGTATATTTGTATGTCTCTTGGTTTCATTGGGCGCTA
CCGATTAGAAAAGAATGGTGTCGAATCTCATCGCAGCTTGCGACAGCGTGTTTTTGACGTTATTACCACC
GTAAGCGAGCGTCCTCCTAAAGTTCTGAGTGATGGTTGGCAGGATAAGGTACGCGTGGGTGAGGAAATCA
CCGAAAGCACACCAGTTTGGGTTACGCTTTCCATTGCGGGAGCCATCCTTGCTGCTACGTACATGGGATT
CAATTACAAGATCAATGAAGAGTCTAACAGGACCTTTACCAACTTACTTAATCTCGTCCCTTCTGTTGAA
ATAACTGAATCGGCACCTTTGGCAGATGTTGCTCCTGTTGCTCTTCGAATTCAGGACTATCTCGCTACCG
AAATGGATCGTGGTGTTGTAGAGATTCAACAGCTTCCAGATAGAGTCAGAATCTCATTTGCAGCAAACGA
ACTGTTTGACTCTGGCAGTGCTGAGCTGACCCAACATATTCGTCCAGTACTGTCTAAAGTAGGTCGTTCT
TTAGAAGGAACGAAAGGTCGAATTATGATTGTTGGTCATACCGACAACAAGCCAATTTTTACTAGTAAGT
TCCCGTCTAACTGGCACCTGTCCCTAGCCAGAGCCACATCGGTAACTAATCATCTTGCTGACAGCAGTAA
TCTTACCGGTCGTTTGATCCCGGAAGGTATGGGAGACGCAAGACCACTTGTTGATAACGACACCGAAGCA
AATCGAGCTAAAAATCGCCGTGTTGAAATCGACTTGTTAGTGGCACAAAGAGCTGTAGGAGGAGAGGAAC
AGTGA
 Primer design