SecReT6
Protein ID: 549688966
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1431
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1528759..1532283 [+]
Productputative Type VI secretion system, IcmF
NoteTssM
UniProt IDU4KF01
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.50E-89, Aligned region: 82..111
ImcF-related_N [PF14331], Evalue: 1.50E-89, Aligned region: 191..451
ImcF-related_N [PF14331], Evalue: 1.50E-89, Aligned region: 879..911
IcmF-related [PF06761], Evalue: 5.60E-81, Aligned region: 503..806
DUF1215 [PF06744], Evalue: 2.20E-39, Aligned region: 917..1036
AAA_19 [PF13245], Evalue: 0.0053, Aligned region: 128..144
Protein Sequence: 1174 a.a.     [Download]
>gi|549688966|ref|YP_008620698.1| putative Type VI secretion system, IcmF [Vibrio nigripulchritudo]
MSFKAVGKFVSQKWFVSLIGLIALSLMIWLVGPLVAVAGHEPLKSETSRLLVLLALMFGWGVVNIRQQKK
EKKEEDESIQNLLEVNAQDDEESAAEIDLLKERIDQAIQVLHKTGKRGKQSIYKLPWYVLIGPPGTGKTT
ALANSGLEFPLSDSLGQDPLSGIGGTRHCDWWFTNKAVLIDTAGRYTTQDSHSEKDSKAWLGFLGLLKKY
RTKRPINGAIVAVSLVSLMSQTRTERGMHARAIKARIQELKNQLGMQFPIYIVLTKADLIAGFNEYFADL
EDEERDQLLGFMFPESSEDEKGVISLFNKEFHHLLESLDKRMNKRLEQETDLDKRALIFEFPKQLRMLQA
NVDEFLSDIFAKNAFEESTMIRGVFIVSAVQEGMPIDRVMNETSSGLGLSQLSLKTSSKESASFFIRSLF
EDIIFREQFLGSVNRHHQKQNRWVKHGALAFSLASVAAFGAIWFQSFQWNKQLITETDDRIANIDEQVKR
IDFDFEDNLVESLELLDEIMGLPMGYAGYYEDVEGIKKFGLYQGDKIGQPAKAAYHQALNGYFSKLLESA
LISEMEASQSHREYLYETLKTYLMLFNPERFDIVHVESWFELYFENNFPGEFNEEKRASLMMHTKNLLAN
DDLGLYVNNDAVQDARNVLTQLPLAERAYQRMKLQFIKSHVPSFRITDVMGSQSLSQFERKSGKPLSAGI
PGFYTFNGFHSIFQMQIGRTVKNLMEDNWVYGDNIDIQAVDHDLAVKGVRERYYRDYIYEWESLINDIAL
KSTPSLELSLIQSRILASSERPVESFLKAVQKEVSLTQVSLSQNEKVAAEVATKAADVALHNKKNAIGRF
MPTENTELAINLPGKEVERAFEGIIKIEQQDFELINQSLVGLREYLSDLSSSGNNQKLAYKSILDGTVTE
DVARSLKRTNQILPAPFNRWLVGLSHESTRLAEKGSQNHLNQIWKTQVVKAYERSIEGRYPFNPSAKNEV
NLKDFKRFFGYGGTLDSFFSDYLEPFVDTSGRVWRFEKEIGVSPETLAVFQRAEKIRQTFFETDNSVKIE
FGLRPKYLDQHISKFKLELGSQKLVYSHGPERTQNLSWPSSKSETRIIFIPPNSSREISHTYEGQWGLYK
MLDQSLKARPETRKDNIVMIDLKGNKVQLELIPSSTINPFWSNDMERFTCPQTL
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1528759-1532283 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
GTGAGTTTTAAAGCTGTAGGGAAATTTGTCAGCCAAAAATGGTTTGTCAGCTTAATTGGTCTGATTGCTC
TGTCACTTATGATCTGGCTGGTTGGTCCGCTAGTGGCCGTTGCTGGTCACGAACCTTTAAAAAGCGAAAC
CTCTCGCCTTCTGGTACTACTAGCACTTATGTTTGGCTGGGGTGTCGTGAACATCCGCCAACAGAAGAAA
GAAAAGAAAGAAGAAGATGAAAGCATTCAGAATCTTCTGGAAGTCAATGCACAAGACGACGAAGAGTCCG
CTGCCGAAATCGATTTGCTTAAAGAAAGAATTGATCAGGCAATTCAAGTCTTACACAAGACGGGTAAACG
CGGAAAGCAAAGCATTTACAAACTGCCTTGGTACGTTTTAATTGGTCCTCCGGGAACAGGTAAAACGACG
GCACTGGCAAATTCTGGTTTGGAGTTCCCACTTTCTGACAGCTTAGGGCAAGATCCTTTGTCTGGGATTG
GTGGAACTCGTCACTGTGACTGGTGGTTTACAAATAAAGCGGTACTGATTGATACCGCAGGTCGTTACAC
GACACAAGACAGTCATTCAGAAAAAGATTCCAAGGCTTGGTTGGGTTTCCTTGGGTTACTTAAAAAGTAC
CGTACGAAACGCCCTATCAATGGTGCCATCGTGGCAGTAAGTTTGGTGAGCTTGATGAGCCAGACTCGTA
CAGAACGAGGCATGCATGCAAGAGCAATTAAGGCGCGTATTCAGGAGCTGAAAAATCAGCTTGGTATGCA
GTTCCCTATTTACATTGTTCTCACCAAAGCTGACCTAATAGCAGGCTTTAATGAATACTTTGCCGATTTA
GAGGACGAAGAACGCGATCAGTTACTTGGTTTCATGTTCCCTGAGTCTTCAGAAGATGAGAAAGGTGTTA
TTTCTCTGTTTAACAAAGAATTTCACCATCTTCTGGAAAGTCTTGATAAGCGCATGAACAAGCGCTTAGA
GCAGGAAACTGATCTAGACAAGCGAGCATTGATTTTTGAGTTTCCAAAGCAGTTAAGAATGCTTCAGGCA
AATGTCGATGAGTTTCTAAGCGATATCTTTGCTAAGAATGCCTTCGAAGAATCAACCATGATTCGTGGTG
TGTTTATCGTGAGTGCGGTTCAGGAAGGCATGCCAATTGACCGCGTAATGAATGAAACATCATCTGGTCT
TGGGCTTTCTCAGCTATCGCTTAAAACCAGCTCTAAAGAGTCAGCGAGTTTCTTCATTCGTTCTCTGTTT
GAAGACATTATATTCAGAGAGCAATTCCTTGGCAGTGTGAACCGTCATCATCAAAAGCAGAACCGTTGGG
TCAAGCATGGTGCACTGGCATTCAGCTTGGCGAGTGTGGCGGCTTTTGGCGCAATCTGGTTCCAAAGTTT
CCAATGGAATAAGCAACTTATCACTGAAACCGATGACCGCATTGCCAATATCGATGAACAAGTGAAGCGA
ATCGATTTTGATTTCGAAGACAACTTAGTGGAATCCCTTGAGTTGCTCGATGAAATCATGGGGCTACCAA
TGGGGTATGCCGGATACTACGAAGACGTTGAAGGCATTAAGAAGTTTGGATTGTATCAGGGCGACAAGAT
AGGGCAGCCAGCGAAAGCTGCCTATCACCAGGCGTTAAATGGCTACTTCTCTAAGCTGTTGGAATCGGCG
CTTATCAGTGAGATGGAAGCGAGTCAGTCGCACCGGGAATACCTGTACGAGACTCTAAAAACATACTTGA
TGCTGTTTAATCCGGAGCGTTTCGATATCGTCCATGTCGAAAGTTGGTTCGAACTCTATTTCGAGAACAA
CTTCCCTGGTGAGTTCAACGAAGAAAAACGTGCTTCTCTGATGATGCATACCAAGAACTTGTTGGCTAAC
GACGACCTCGGGTTATACGTAAACAATGACGCAGTCCAAGACGCGCGAAATGTACTTACTCAGTTGCCGT
TGGCAGAGCGTGCTTATCAGCGAATGAAACTGCAATTCATTAAGAGTCATGTACCTTCATTCCGAATCAC
AGATGTTATGGGGTCACAAAGCCTTAGTCAGTTTGAGCGTAAAAGCGGCAAACCACTTTCTGCAGGAATA
CCTGGGTTCTACACCTTTAATGGTTTCCACAGTATTTTCCAGATGCAGATTGGACGTACAGTTAAAAACC
TGATGGAAGATAACTGGGTCTATGGCGACAACATAGATATTCAGGCGGTAGATCATGATCTTGCGGTTAA
AGGTGTACGCGAGCGTTACTACAGAGATTACATCTATGAATGGGAATCTTTGATTAACGATATTGCTCTT
AAGTCGACACCAAGTCTAGAACTTAGTCTGATCCAAAGCCGAATTCTCGCGAGTTCTGAGCGTCCGGTGG
AATCTTTCCTGAAAGCAGTTCAGAAAGAAGTTTCGCTAACGCAAGTGTCGCTAAGCCAAAACGAAAAAGT
GGCTGCTGAAGTGGCGACAAAAGCTGCCGATGTTGCGCTGCACAACAAGAAAAACGCTATTGGTCGATTC
ATGCCTACCGAGAACACAGAGCTGGCTATCAACCTTCCAGGCAAAGAGGTAGAAAGAGCGTTCGAAGGTA
TCATCAAAATCGAGCAACAGGATTTTGAACTGATCAACCAGTCTCTTGTTGGGTTGAGAGAATACTTGTC
CGACTTATCAAGTTCAGGTAACAACCAGAAACTGGCATACAAGAGCATTTTGGATGGAACAGTAACTGAA
GACGTTGCGCGTTCACTTAAGCGTACTAATCAGATTCTGCCTGCTCCGTTTAACCGTTGGTTAGTTGGTC
TTTCTCATGAATCAACACGCTTGGCAGAAAAGGGTTCTCAGAATCACTTGAACCAGATTTGGAAAACTCA
AGTGGTTAAAGCTTATGAGCGAAGCATTGAAGGTCGATACCCATTCAATCCTTCTGCTAAGAATGAAGTG
AACCTGAAAGACTTCAAACGCTTCTTTGGTTACGGCGGTACATTAGACAGTTTCTTCTCAGACTACTTGG
AGCCGTTTGTCGATACATCCGGACGTGTATGGCGCTTCGAGAAAGAAATTGGAGTAAGCCCTGAGACGTT
AGCTGTGTTCCAGCGTGCAGAGAAAATCAGACAGACTTTCTTCGAAACCGATAACTCAGTGAAGATTGAG
TTCGGCTTGAGACCAAAATATCTGGACCAACATATTTCTAAGTTCAAGTTAGAGCTGGGTTCACAAAAAC
TGGTTTACAGCCATGGTCCAGAGCGTACTCAGAATTTGTCTTGGCCATCAAGCAAGTCGGAAACACGAAT
TATCTTTATTCCGCCTAACTCATCCAGAGAGATCTCACACACCTACGAAGGTCAATGGGGTCTGTACAAG
ATGCTCGATCAGTCGCTGAAGGCTCGTCCTGAAACACGTAAGGACAACATTGTCATGATTGATCTCAAGG
GGAATAAGGTTCAATTGGAGTTAATACCGAGCAGCACCATTAACCCATTCTGGTCGAACGATATGGAGCG
ATTTACATGTCCTCAAACCTTATAA
 Primer design