SecReT6
Protein ID: 549688969
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1434
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1533759..1534886 [+]
Productputative Type VI secretion system-associated, ImpA
NoteTssA
UniProt IDU4K4P6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.00E-20, Aligned region: 75..129
Protein Sequence: 375 a.a.     [Download]
>gi|549688969|ref|YP_008620701.1| putative Type VI secretion system-associated, ImpA [Vibrio nigripulchritudo]
MMYEASDFEWIEQALLPISEEAPAGADPRSDVSPQSAYFRLKDQRMVARNEERNAIIVEEPLLNYVNLWI
PFLETVPEQLSNHSKDLELVAWVIEAMTRAYGFKGFAEGYQLAAQLIENFWDHLHPMPDEDGIETRVTPI
IGLNGIEKEGTLLFPLSSIPLTETHTGQSYAYWEYQQAVDLERLDEDKKRQKLDGGAVELKSIQDAVNQS
SKEFYQQLGEDLALAIEAFNRYSQSMDDACGEVMPSSHIQKKLEAIQSALNHLAGDRLKADVAVETELEE
VVEEAADGTVETVAVPAGQLLAANLASREHAIEQLKKIAEFFKETEPHSPVSYSIEQVVRWCDMPLPDLL
AELISDGEAKNGYFRLVGIVDQDGE
 
Nucleotide Sequence: 1128 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1533759-1534886 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGATGTACGAAGCCTCCGATTTTGAATGGATCGAACAAGCACTTCTTCCAATATCTGAAGAAGCGCCAG
CAGGTGCCGATCCGCGCTCTGATGTAAGCCCACAGTCGGCTTACTTTCGTTTGAAAGACCAGCGTATGGT
CGCTCGAAATGAAGAACGCAATGCGATCATCGTTGAAGAACCTCTACTCAATTACGTCAATCTCTGGATT
CCGTTTCTTGAAACCGTTCCAGAGCAATTGTCCAACCACTCAAAAGACTTGGAACTGGTTGCTTGGGTGA
TTGAGGCGATGACGCGAGCCTATGGGTTCAAAGGATTTGCAGAGGGCTACCAATTAGCCGCTCAACTTAT
TGAAAACTTCTGGGATCATCTTCATCCGATGCCCGATGAAGATGGAATCGAGACGCGCGTCACTCCAATC
ATTGGACTAAACGGAATAGAGAAAGAGGGCACTTTACTGTTTCCTCTGTCTTCCATTCCACTTACAGAGA
CTCATACGGGGCAGTCATACGCCTACTGGGAGTATCAGCAAGCGGTCGATCTGGAACGTTTAGACGAAGA
CAAGAAGCGCCAAAAACTGGATGGCGGTGCTGTAGAGCTTAAGTCGATTCAAGACGCGGTTAACCAGTCT
TCGAAGGAATTCTACCAGCAGCTAGGAGAAGACCTTGCCTTAGCGATTGAAGCATTTAATCGATATAGCC
AGTCCATGGATGATGCTTGTGGCGAAGTAATGCCAAGCTCTCATATCCAGAAGAAGCTTGAAGCCATTCA
ATCTGCACTTAACCACTTGGCTGGTGACAGGCTTAAAGCAGATGTGGCAGTAGAAACAGAATTAGAAGAA
GTCGTTGAAGAGGCTGCAGACGGAACAGTAGAAACGGTTGCGGTACCTGCAGGTCAGCTGTTAGCGGCGA
ACTTGGCATCGAGAGAGCATGCCATAGAGCAACTCAAAAAGATTGCGGAGTTCTTTAAGGAAACTGAACC
ACATTCCCCCGTTTCGTATTCAATCGAGCAGGTAGTGAGGTGGTGTGATATGCCTTTGCCAGACTTGTTG
GCAGAGCTTATTTCTGATGGAGAAGCCAAGAACGGCTACTTCCGTTTGGTTGGCATAGTAGACCAAGATG
GCGAATAA
 Primer design