SecReT6
Protein ID: 549688970
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1435
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1534905..1535426 [+]
Producthypothetical protein
NoteTssB
UniProt IDU4KB65
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-61, Aligned region: 8..163
Protein Sequence: 173 a.a.     [Download]
>gi|549688970|ref|YP_008620702.1| conserved hypothetical protein [Vibrio nigripulchritudo]
MTSIHSKLSRVRKPRVHITYDVETENASLKKELPFVLGVMGDFAGHNTEALKPLKDRRFIQIDRDNFDDV
LKKMSPTLSFKVDNKLADDDSTFTVDLRFNSMKDFEPASIVNQVDPLRKLMETRNKLRDLMTKVDRSEEL
EDVLESVLNNTDNLEKLAGELNLNEGDKKEGDE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1534905-1535426 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGACGAGTATCCACTCGAAACTTTCACGAGTAAGGAAGCCTCGTGTTCATATTACGTATGACGTAGAAA
CTGAAAATGCTTCACTTAAAAAAGAACTGCCTTTTGTTCTTGGTGTAATGGGTGATTTTGCGGGACACAA
CACTGAAGCGCTAAAGCCGCTTAAAGACCGTCGCTTTATCCAGATTGATCGCGATAACTTTGACGACGTT
CTAAAGAAAATGAGCCCGACTCTGTCGTTTAAAGTGGATAACAAGCTTGCTGATGATGACTCAACGTTTA
CCGTTGATCTGCGCTTCAATTCCATGAAGGACTTCGAGCCAGCTTCCATCGTAAATCAGGTTGATCCTTT
ACGTAAGCTAATGGAAACCCGAAACAAACTTCGTGACTTGATGACGAAAGTAGACCGTTCTGAAGAGCTG
GAAGACGTACTGGAGTCCGTATTGAATAACACAGACAACTTAGAGAAGTTGGCTGGTGAACTGAACCTCA
ATGAAGGTGATAAGAAGGAGGGAGATGAGTAA
 Primer design