SecReT6
Protein ID: 549688971
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1436
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1535426..1536919 [+]
Producthypothetical protein
NoteTssC
UniProt IDU4KF05
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.10E-190, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|549688971|ref|YP_008620703.1| conserved hypothetical protein [Vibrio nigripulchritudo]
MSTQTEQQLDPTVGEQSASFLEQAIGATKQTEASRAEELIKTLTEEAMKGTVTWNKNLTVTFREAIAALD
SQISKQLAAVMHHPELQKLEGTWRGLQYLTSNSETSATLKIRLMSMTKKELHKDLSKAVEFDQSQIFKKV
YESEFGSAGGEPYGALIGDYEFTNHPEDIETLGLMSNVAAAGFAPFLSAASPALFGFDEWTELSKPRDLE
KVFESLEYTQWRSFRESADSRFVSLTMPKVLARLPYGEATAPVEEFGYEEFEVDPVSGIAINANHNDYCW
MNSSYVMGAKLTDAFAKYGFCTAIRGAEGGGRVENLPTHFFQSDDGDPDMKCPTEIGITDRREAELSKLG
FLPLCHYKNTNYAVFFGAQTCQKPAKYDSPEATANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILSYVNASEGGGQEIRAKYPLADAKVQVKEIPGSPGAYNAVAWLKPWLQMEELTTSLRLVA
KIPESGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1535426-1536919 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGAGTACTCAAACTGAACAGCAGTTAGACCCTACCGTTGGTGAACAGAGTGCTTCTTTTCTAGAGCAGG
CGATTGGTGCGACTAAGCAGACAGAAGCTTCACGTGCGGAAGAGCTGATCAAAACGCTAACTGAAGAAGC
GATGAAAGGTACGGTAACCTGGAACAAGAACTTGACCGTAACTTTCCGTGAAGCGATTGCAGCTTTAGAT
AGTCAAATTTCAAAGCAGTTGGCTGCGGTAATGCACCACCCTGAACTTCAGAAGCTTGAGGGTACTTGGC
GTGGACTGCAATATCTGACTTCTAACTCAGAAACAAGCGCAACGCTAAAAATTCGTCTGATGAGCATGAC
GAAGAAAGAGCTTCACAAAGACTTGAGTAAAGCGGTTGAGTTTGACCAAAGCCAGATCTTTAAGAAAGTA
TACGAATCAGAGTTTGGTAGCGCTGGTGGTGAACCTTACGGTGCACTGATTGGTGACTACGAATTTACTA
ACCACCCAGAAGATATTGAGACTCTTGGTCTTATGTCTAACGTCGCAGCAGCGGGCTTTGCTCCGTTCCT
TTCTGCGGCATCTCCTGCGCTTTTCGGGTTTGATGAGTGGACAGAACTTTCTAAACCACGTGATTTGGAA
AAAGTATTTGAATCTCTGGAATACACGCAGTGGCGTTCTTTCCGTGAAAGTGCGGACTCTCGCTTTGTTT
CTCTTACTATGCCAAAAGTGCTTGCTCGTTTGCCATACGGTGAAGCAACAGCTCCGGTTGAAGAATTTGG
CTATGAAGAGTTTGAAGTTGACCCAGTATCTGGCATTGCGATCAACGCAAACCACAATGATTACTGCTGG
ATGAACTCGTCTTACGTGATGGGTGCAAAACTGACCGATGCATTCGCTAAATATGGCTTCTGTACTGCTA
TCCGTGGTGCTGAAGGCGGTGGTCGCGTAGAAAACTTACCAACGCACTTCTTCCAGAGTGACGATGGTGA
CCCGGATATGAAATGTCCAACAGAAATCGGCATTACTGACCGTCGTGAAGCAGAGCTGAGTAAACTGGGC
TTCTTGCCTCTTTGTCACTACAAAAATACCAACTACGCGGTGTTCTTTGGTGCTCAGACGTGTCAGAAGC
CAGCTAAGTACGACAGCCCTGAAGCAACGGCAAACGCGGCAATTTCTGCACGTCTTCCATACATGATGGC
GACTTCGCGTTTTGCTCATTATCTGAAGGTTATGGCACGTGACAAGATCGGTAGCTTCATGGAAGCAGAA
GACGTTGAGTCATGGCTAAACCGTTGGATCCTGTCTTACGTGAACGCATCAGAAGGTGGCGGTCAGGAAA
TCCGTGCTAAGTACCCTCTGGCTGATGCAAAAGTACAGGTTAAAGAAATTCCTGGAAGCCCAGGTGCTTA
CAACGCTGTAGCGTGGTTGAAACCATGGCTACAAATGGAAGAACTGACTACGTCTCTTCGTCTTGTTGCG
AAGATCCCTGAGTCAGGCGGTTAA
 Primer design