SecReT6
Protein ID: 549688972
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1437
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1536958..1538463 [+]
Producthypothetical protein
NoteTssC
UniProt IDU4K4H8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.50E-160, Aligned region: 63..495
Protein Sequence: 501 a.a.     [Download]
>gi|549688972|ref|YP_008620704.1| conserved hypothetical protein [Vibrio nigripulchritudo]
MTEFHFVEPELLIHDVQTPQDPTLDAIWLDRFLDLQSDSQSLKYWCDANNIRSVEEMHQSLLSVIDLIDE
QLNEQINAILHHEEFQAFEAGWRGVEYLVNQKDSFGSEQSSKIKILSCSWEELRRDSQRAIEFDQSGLFK
LVYQNEFSTPGGEPFGLIVGNYCISHQAGTNKLDRDMTLVRKISQTAAAAFCPVLISATPSLFGVDAFSE
LATILDVHAQFDQMEYKNWQAVRDSEDAKFVAVTVPYVLMRQPYKYDGSRLDAFAFKEKVTNSESDMLWG
SASFCFAATVLRAYSESGWFAHIRGLKAGSYGQGVILPPVGSQMQFPGKAKRHRSPVNYQISESRELALS
DCGFIPLSPVSDSPLIAFTSNSSLHKPKVYEEKGITVNSRLSSMLQYTLCVARIAHYIKVMGRDKVGSYQ
NAASIEGDFQRWLHQYTTASDEASDELRAKYPLNEAKIQVKEKQGSPGHYYSIIHLRPHFQLDQMVSSVR
LITELAPDKTI
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1536958-1538463 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGACAGAATTTCATTTTGTAGAACCAGAACTGTTGATTCACGATGTGCAGACACCCCAAGACCCAACCT
TGGATGCCATATGGCTCGACCGTTTTCTTGACTTACAGTCCGATTCACAATCTCTGAAATATTGGTGCGA
CGCAAACAACATTCGCAGTGTTGAAGAGATGCATCAAAGTTTACTGAGTGTTATTGATCTGATTGATGAG
CAACTGAATGAGCAGATAAACGCGATTCTTCATCACGAGGAGTTCCAGGCTTTTGAAGCGGGTTGGCGTG
GCGTCGAATATCTGGTGAATCAAAAAGACAGTTTTGGTTCCGAGCAAAGCTCCAAGATAAAGATCTTATC
GTGCAGTTGGGAAGAGCTCAGACGGGATAGTCAGCGAGCTATCGAGTTTGATCAAAGTGGTCTGTTTAAA
CTTGTCTACCAAAATGAATTTTCTACTCCCGGAGGGGAGCCATTTGGTCTGATTGTGGGGAACTATTGCA
TCTCTCATCAAGCGGGGACTAATAAGCTTGATAGAGACATGACACTGGTTCGGAAGATCAGCCAGACAGC
GGCAGCAGCGTTTTGCCCGGTTTTGATTTCAGCAACTCCTAGTTTATTCGGAGTTGATGCGTTTTCAGAA
TTGGCGACGATATTGGATGTGCATGCGCAATTTGACCAAATGGAATATAAGAACTGGCAGGCAGTCCGTG
ACAGTGAAGATGCCAAATTCGTCGCGGTTACGGTGCCTTACGTTCTTATGCGTCAGCCGTACAAATACGA
TGGCAGTCGACTGGATGCTTTTGCGTTTAAAGAAAAGGTGACCAATTCAGAAAGCGATATGCTGTGGGGC
AGCGCTTCGTTTTGTTTTGCCGCCACAGTGTTAAGAGCCTACAGCGAGTCGGGATGGTTTGCCCATATCA
GGGGATTGAAAGCTGGAAGCTACGGACAGGGAGTGATACTTCCACCTGTAGGTAGCCAGATGCAATTCCC
GGGTAAAGCGAAAAGACACCGTTCCCCAGTGAATTATCAAATCTCTGAATCAAGAGAGTTGGCGCTATCA
GACTGTGGATTTATTCCGCTTTCACCGGTATCAGACAGCCCACTGATTGCCTTTACTTCTAACTCTTCAT
TGCACAAGCCAAAAGTGTATGAAGAAAAGGGAATTACGGTGAACTCAAGGCTGTCTTCGATGTTGCAATA
CACATTGTGTGTCGCGCGCATTGCTCACTACATCAAGGTAATGGGACGCGACAAAGTGGGCAGCTATCAA
AATGCAGCGAGTATTGAGGGCGATTTCCAACGTTGGTTACATCAGTACACCACTGCGTCAGATGAAGCTT
CAGATGAGTTGAGGGCTAAGTACCCGCTCAACGAAGCAAAAATTCAGGTTAAAGAAAAACAAGGCAGTCC
TGGGCACTACTACTCGATCATTCATTTGAGACCACATTTCCAACTCGATCAGATGGTTTCAAGTGTCAGA
TTAATCACCGAGCTTGCTCCGGACAAAACGATATAA
 Primer design