SecReT6
Protein ID: 549688973
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1438
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1538478..1539281 [+]
Productputative virulence protein, SciE type
NoteTagJ
UniProt IDU4JXB5
KEGG IDvni:VIBNI_A1438
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.30E-31, Aligned region: 138..259
DUF3366 [PF11846], Evalue: 0.0071, Aligned region: 10..68
DUF3366 [PF11846], Evalue: 0.0071, Aligned region: 92..135
Protein Sequence: 267 a.a.     [Download]
>gi|549688973|ref|YP_008620705.1| putative virulence protein, SciE type [Vibrio nigripulchritudo]
MSDWQQLVRQAKLQETLDSVIQSIKSNPKDAALRSYFIELLCIDGQLERADEQLMQATKLFPEFLAGASQ
IRHLVKAAQARVDFVQGGATANFLGSNEQQYATLTQLNLAIHEGNAEEVERLSEELESLRPETTLTINGT
EYPDVRDIDDSLNGFIELYSSTGNYYLAPLDQVEYLNIKPASNLLETIWRPVEFSIKGITEGEAHIPLTY
SRSDRDANKLGKETDWHPVVEDKVFVGHGQKVWLAGESALPLATIENIEKEKQEAEA
 
Nucleotide Sequence: 804 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1538478-1539281 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGTCAGATTGGCAGCAATTAGTACGTCAAGCAAAATTGCAGGAAACACTGGATTCGGTCATCCAGTCAA
TCAAGTCAAACCCAAAAGATGCCGCTCTCAGAAGCTATTTTATTGAGCTGCTTTGTATTGACGGGCAGTT
AGAACGAGCTGACGAACAACTGATGCAGGCGACAAAACTCTTCCCGGAATTCCTGGCTGGTGCAAGCCAG
ATTCGCCATCTTGTAAAAGCCGCGCAAGCGCGAGTTGATTTTGTGCAAGGTGGAGCCACAGCAAACTTTT
TAGGTTCCAATGAACAGCAGTACGCCACATTGACCCAATTGAATCTTGCTATTCACGAGGGGAATGCAGA
AGAAGTAGAACGTCTGAGTGAAGAACTTGAGTCTTTGAGACCAGAAACGACACTAACCATTAACGGTACT
GAGTATCCGGATGTGCGTGATATCGATGATTCATTAAACGGCTTTATCGAACTCTATAGCTCTACAGGTA
ACTACTATCTGGCACCACTTGATCAGGTTGAATACCTGAACATTAAACCTGCCAGCAACTTGTTGGAAAC
CATCTGGAGACCAGTCGAGTTCTCTATTAAAGGCATCACGGAAGGTGAAGCTCATATACCTCTGACATAT
TCTCGTAGCGACAGAGACGCGAACAAGCTAGGTAAAGAGACGGATTGGCACCCTGTAGTTGAAGACAAGG
TGTTTGTCGGTCATGGACAAAAAGTCTGGCTAGCGGGTGAAAGTGCACTGCCATTAGCCACCATCGAAAA
TATCGAGAAAGAAAAGCAAGAAGCTGAAGCGTAG
 Primer design