SecReT6
Protein ID: 549688974
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1439
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1539292..1539774 [+]
Productputative Type VI secretion system, lysozyme-related
NoteTssE
UniProt IDU4K4Q1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.80E-18, Aligned region: 36..137
Protein Sequence: 160 a.a.     [Download]
>gi|549688974|ref|YP_008620706.1| putative Type VI secretion system, lysozyme-related [Vibrio nigripulchritudo]
MENRSHVGNGVSLLDKLIDLDPSTTVDTQFPLSNQQVVKGLIRDVEALLNTRLSWVKVDNDLPELRQSLL
TYGLPDFSSMPFSSKDGQQHLCRIVRETILEFEPRFKEVLVAIIEDKEQLDRILRLRINAVYELGKKHHE
LVLDSEVEPVSLGITVSESA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1539292-1539774 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGGAAAATAGATCCCATGTTGGCAATGGCGTTTCTTTGCTAGACAAGCTTATCGATTTAGACCCGAGTA
CGACTGTTGATACTCAGTTTCCACTGAGTAATCAACAGGTAGTGAAAGGACTGATAAGAGACGTAGAAGC
GTTGCTCAATACTCGTCTGAGTTGGGTAAAAGTTGACAACGACTTACCAGAGTTACGGCAGTCACTTTTA
ACTTATGGCTTGCCAGATTTTTCTTCGATGCCTTTCAGTAGCAAGGATGGGCAGCAGCACCTGTGCAGAA
TTGTGAGAGAAACAATCTTAGAGTTTGAACCTCGGTTCAAGGAAGTTCTTGTTGCGATTATTGAAGACAA
AGAACAGCTAGACAGGATTTTGCGCCTGCGGATTAATGCCGTCTATGAGCTAGGTAAAAAGCACCATGAA
CTGGTGTTAGATTCCGAAGTAGAACCGGTAAGTTTAGGAATAACGGTGAGTGAATCGGCATGA
 Primer design