SecReT6
Protein ID: 549688975
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1440
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1539771..1541594 [+]
Productputative Type VI secretion system, VCA0110
NoteTssF
UniProt IDU4KB68
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-188, Aligned region: 5..607
Protein Sequence: 607 a.a.     [Download]
>gi|549688975|ref|YP_008620707.1| putative Type VI secretion system, VCA0110 [Vibrio nigripulchritudo]
MSDEFLKYYNRELAYLRHKGQEFGATYPKIAARLKLSEEQVEDPHVARIMEGCAFLTAQIRQSLDNSFPQ
LTEALIGQLFPDFHAPIPSMSVVKIDSDESATSKVTVKKGESVTFDAPGFKACQFRTCYETDVLPLNISE
ASFENAPFRGQLLDIEKEAKSVLKLTLKGASKEIEINGLNFDSLRLFFNGQPQVTYKLLQFFLQSAIGMA
VVVDDETRRQLTPRHIKPVGYEAEHSVVPYSKRSFVGSRLLVEYFLFPEKFLFADLLNLESAWFGDQDEA
EFWIYFDQSCDWLEKQVTKDTVLLGCTPVINMFSHAMEPTRIVASEYEFPLYPEHLEPDTTEVIGIQEIG
VRSWQMKYQSLPPFYAGEHTNYLSEHEIYWTMRREDKSWAGGFDEPGRDVYVSFVDKEHKLFTPDSKDNW
VMSAQAWCCNRNLPKKLPFGGGMPNVNLPDVKDNFDSTKCLVAPTETIRPSMDASSRWQFAKLLTLSHFS
GSDGLKTLRETLNLYAFKASPESKAMIDSIVSMDAKPATGRVNQKGRVGFCHGTEITLEVSDSAQSEEQI
FFLGNVLSTFFAQYAEINTFTKLCIRLKSSGDVFHRWPALCGDKVLL
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1539771-1541594 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGAGTGATGAATTCTTAAAGTATTACAACCGTGAGCTCGCGTATCTACGACACAAAGGTCAAGAGTTTG
GTGCAACTTATCCGAAAATCGCGGCACGGCTGAAATTGAGCGAGGAACAGGTTGAAGATCCTCACGTTGC
CAGAATCATGGAAGGCTGCGCTTTTCTTACTGCACAGATTCGTCAGAGTCTGGATAACAGTTTCCCTCAA
TTGACGGAAGCACTTATTGGTCAGTTATTTCCCGACTTCCACGCTCCGATTCCATCGATGAGTGTGGTTA
AAATTGACAGCGATGAGTCGGCGACATCTAAGGTAACAGTAAAGAAAGGTGAGTCGGTTACTTTTGATGC
CCCTGGGTTTAAGGCTTGTCAGTTCAGAACATGTTATGAAACCGACGTACTCCCGTTAAATATCAGTGAA
GCGTCGTTTGAAAATGCACCCTTTAGAGGGCAGTTGCTCGATATTGAAAAAGAAGCTAAATCGGTACTCA
AACTCACTCTGAAAGGGGCGAGTAAAGAAATTGAGATCAATGGGCTGAACTTTGACTCTCTGCGCCTGTT
CTTTAACGGGCAACCTCAGGTCACTTACAAATTACTTCAGTTCTTCCTTCAGTCAGCCATCGGTATGGCT
GTCGTTGTGGATGATGAAACTCGGCGTCAGTTAACTCCACGCCATATTAAACCTGTGGGTTACGAGGCAG
AACACTCCGTTGTGCCTTACAGCAAAAGAAGTTTTGTTGGTAGCCGCTTGTTGGTTGAATACTTCCTGTT
CCCAGAAAAGTTCCTGTTTGCTGATTTGCTTAACCTGGAATCCGCTTGGTTTGGCGATCAAGACGAGGCT
GAATTCTGGATTTACTTTGATCAAAGTTGTGACTGGCTTGAGAAGCAGGTGACAAAAGACACCGTTCTTC
TTGGCTGCACACCGGTGATAAACATGTTCAGCCACGCGATGGAGCCAACTCGAATTGTAGCATCGGAGTA
CGAGTTCCCGCTTTATCCAGAGCACCTCGAACCCGACACAACCGAAGTGATTGGTATTCAGGAGATAGGT
GTTCGTAGCTGGCAGATGAAATATCAGAGCCTGCCGCCGTTTTACGCAGGGGAACATACAAACTACCTTT
CTGAACACGAAATTTACTGGACGATGCGCCGTGAAGATAAAAGCTGGGCTGGTGGGTTTGATGAGCCTGG
ACGAGATGTCTATGTTTCATTTGTCGATAAAGAACACAAACTGTTTACACCCGACAGCAAAGACAATTGG
GTGATGTCAGCTCAGGCATGGTGTTGTAATCGAAACCTGCCTAAGAAGCTTCCTTTTGGTGGTGGAATGC
CCAACGTCAACTTACCGGACGTAAAAGATAACTTCGACAGCACTAAGTGTCTGGTTGCACCAACAGAAAC
GATTCGTCCGTCCATGGATGCAAGTTCCCGCTGGCAATTTGCCAAGCTACTGACTCTGTCTCATTTCTCT
GGTTCTGATGGACTAAAAACGTTACGAGAAACTCTTAATCTCTATGCATTCAAAGCGTCACCAGAATCTA
AAGCCATGATTGATTCAATCGTATCTATGGACGCCAAGCCCGCAACTGGGCGAGTGAATCAGAAAGGGCG
AGTGGGTTTCTGTCATGGCACCGAAATTACTCTTGAAGTTTCTGACAGTGCCCAATCGGAAGAGCAAATC
TTCTTCCTGGGCAATGTATTGTCGACGTTCTTTGCACAGTATGCCGAGATCAATACATTTACCAAGCTCT
GTATTCGGTTAAAGAGTTCAGGAGACGTTTTTCATCGTTGGCCTGCTTTGTGCGGTGACAAGGTGTTGCT
ATGA
 Primer design