SecReT6
Protein ID: 549688976
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1441
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1541591..1542556 [+]
Producthypothetical protein
NoteTssG
UniProt IDU4KF07
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-66, Aligned region: 14..306
Protein Sequence: 321 a.a.     [Download]
>gi|549688976|ref|YP_008620708.1| conserved hypothetical protein [Vibrio nigripulchritudo]
MKQEKFLESLDKEKLFESLHLIEQFLLKSESNLGTDHLPSQENIELKVAQQLGYEIGEFTKIKPKHDQSL
IVMTNLIGLTGENGVLPKHYSELILQRLKADDPTLQDFLDIFNHRILSLFYRTWQNFQPTVQHRRVSQNT
FSPWDQVLTSLTGNLGDRAIHWGGLFGKPVKSRGAIQACLESLSGCEVEIHDFKGKWMQLTDDEQTRLCS
KKMPEGQFSELGRGASLGQKAWNVNAGFTVEFTAKGQDQVHGMMPKGERITEIKALCQDLLGETASIEWT
LTAEYKHLPKVQLKKGGGRLALGSVLAPHKRSENNTITIRI
 
Nucleotide Sequence: 966 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1541591-1542556 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGAAGCAAGAAAAGTTTCTGGAAAGCCTTGATAAAGAAAAACTGTTCGAATCGCTTCATTTGATTGAAC
AATTTCTTCTGAAATCTGAATCGAATTTAGGAACGGATCATCTTCCAAGTCAGGAAAATATCGAACTCAA
AGTTGCGCAGCAATTGGGTTATGAGATTGGAGAATTCACCAAAATAAAGCCTAAGCACGATCAGAGTTTG
ATTGTAATGACCAATCTGATTGGGCTGACAGGAGAAAATGGTGTTCTTCCCAAGCATTATAGTGAGTTGA
TCCTACAAAGGTTGAAAGCGGATGATCCTACGCTTCAGGATTTTCTGGACATTTTCAACCACCGAATCTT
GTCACTTTTCTACCGAACCTGGCAAAACTTTCAGCCAACAGTTCAGCATCGAAGAGTATCCCAGAATACG
TTCTCACCTTGGGATCAGGTGTTGACGTCTCTTACTGGCAACCTTGGTGACAGGGCTATCCATTGGGGTG
GGCTTTTTGGCAAACCAGTCAAAAGCCGGGGTGCCATCCAGGCTTGCCTGGAATCTCTTTCCGGTTGTGA
AGTCGAAATTCATGACTTTAAAGGGAAGTGGATGCAGCTAACCGATGATGAGCAAACACGTTTGTGTTCG
AAGAAGATGCCAGAAGGGCAGTTTTCCGAACTTGGACGGGGGGCGAGTCTGGGGCAAAAGGCCTGGAACG
TAAATGCCGGATTTACCGTTGAATTCACCGCAAAAGGGCAGGACCAAGTACACGGCATGATGCCCAAAGG
TGAGCGAATCACAGAAATAAAAGCGCTTTGTCAGGATTTACTGGGCGAAACCGCATCAATTGAATGGACT
CTGACTGCTGAATATAAGCATTTGCCCAAAGTGCAACTCAAAAAAGGTGGGGGAAGGCTAGCGCTTGGTA
GCGTACTCGCTCCACACAAACGATCTGAAAACAACACTATCACTATCCGAATTTAA
 Primer design