SecReT6
Protein ID: 549688977
SecReT6 ID855
T6SS typei5
Gene symbolclpB
Locus tagVIBNI_A1442
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1542592..1545159 [+]
ProductChaperone protein clpB
NoteTssH
UniProt IDU4K4I2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.10E-40, Aligned region: 124..152
AAA_2 [PF07724], Evalue: 5.10E-40, Aligned region: 213..230
AAA_2 [PF07724], Evalue: 5.10E-40, Aligned region: 588..755
AAA [PF00004], Evalue: 5.20E-19, Aligned region: 213..345
AAA [PF00004], Evalue: 5.20E-19, Aligned region: 593..711
ClpB_D2-small [PF10431], Evalue: 5.70E-14, Aligned region: 501..520
ClpB_D2-small [PF10431], Evalue: 5.70E-14, Aligned region: 760..830
AAA_16 [PF13191], Evalue: 3.90E-13, Aligned region: 190..229
AAA_16 [PF13191], Evalue: 3.90E-13, Aligned region: 256..291
AAA_16 [PF13191], Evalue: 3.90E-13, Aligned region: 397..518
AAA_16 [PF13191], Evalue: 3.90E-13, Aligned region: 561..617
AAA_16 [PF13191], Evalue: 3.90E-13, Aligned region: 657..686
AAA_16 [PF13191], Evalue: 3.90E-13, Aligned region: 755..830
AAA_5 [PF07728], Evalue: 3.20E-11, Aligned region: 213..233
AAA_5 [PF07728], Evalue: 3.20E-11, Aligned region: 592..713
Clp_N [PF02861], Evalue: 2.40E-09, Aligned region: 24..75
Clp_N [PF02861], Evalue: 2.40E-09, Aligned region: 107..140
AAA_22 [PF13401], Evalue: 6.10E-08, Aligned region: 212..294
AAA_22 [PF13401], Evalue: 6.10E-08, Aligned region: 589..624
Sigma54_activat [PF00158], Evalue: 2.40E-07, Aligned region: 210..227
Sigma54_activat [PF00158], Evalue: 2.40E-07, Aligned region: 571..710
IstB_IS21 [PF01695], Evalue: 4.70E-07, Aligned region: 207..236
IstB_IS21 [PF01695], Evalue: 4.70E-07, Aligned region: 592..626
IstB_IS21 [PF01695], Evalue: 4.70E-07, Aligned region: 703..726
IstB_IS21 [PF01695], Evalue: 4.70E-07, Aligned region: 782..828
AAA_19 [PF13245], Evalue: 8.00E-06, Aligned region: 213..234
AAA_19 [PF13245], Evalue: 8.00E-06, Aligned region: 588..616
AAA_14 [PF13173], Evalue: 1.60E-05, Aligned region: 213..345
AAA_14 [PF13173], Evalue: 1.60E-05, Aligned region: 589..687
NACHT [PF05729], Evalue: 7.30E-05, Aligned region: 213..240
NACHT [PF05729], Evalue: 7.30E-05, Aligned region: 406..443
NACHT [PF05729], Evalue: 7.30E-05, Aligned region: 593..617
NACHT [PF05729], Evalue: 7.30E-05, Aligned region: 803..825
Arch_ATPase [PF01637], Evalue: 9.10E-05, Aligned region: 191..226
Arch_ATPase [PF01637], Evalue: 9.10E-05, Aligned region: 265..362
Arch_ATPase [PF01637], Evalue: 9.10E-05, Aligned region: 469..479
Arch_ATPase [PF01637], Evalue: 9.10E-05, Aligned region: 585..631
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 213..290
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 588..613
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 655..676
NTPase_1 [PF03266], Evalue: 0.00045, Aligned region: 213..235
NTPase_1 [PF03266], Evalue: 0.00045, Aligned region: 505..535
NTPase_1 [PF03266], Evalue: 0.00045, Aligned region: 592..621
AAA_29 [PF13555], Evalue: 0.00079, Aligned region: 205..229
AAA_29 [PF13555], Evalue: 0.00079, Aligned region: 587..603
AAA_17 [PF13207], Evalue: 0.00089, Aligned region: 213..232
AAA_17 [PF13207], Evalue: 0.00089, Aligned region: 592..630
AAA_10 [PF12846], Evalue: 0.00096, Aligned region: 47..123
AAA_10 [PF12846], Evalue: 0.00096, Aligned region: 213..227
AAA_10 [PF12846], Evalue: 0.00096, Aligned region: 281..300
AAA_10 [PF12846], Evalue: 0.00096, Aligned region: 402..504
AAA_10 [PF12846], Evalue: 0.00096, Aligned region: 589..623
Zeta_toxin [PF06414], Evalue: 0.001, Aligned region: 213..231
Zeta_toxin [PF06414], Evalue: 0.001, Aligned region: 587..633
DUF2075 [PF09848], Evalue: 0.0011, Aligned region: 10..79
DUF2075 [PF09848], Evalue: 0.0011, Aligned region: 213..315
DUF2075 [PF09848], Evalue: 0.0011, Aligned region: 591..627
AAA_18 [PF13238], Evalue: 0.0017, Aligned region: 213..233
AAA_18 [PF13238], Evalue: 0.0017, Aligned region: 456..527
AAA_18 [PF13238], Evalue: 0.0017, Aligned region: 593..627
AAA_23 [PF13476], Evalue: 0.0019, Aligned region: 213..230
AAA_23 [PF13476], Evalue: 0.0019, Aligned region: 421..471
AAA_23 [PF13476], Evalue: 0.0019, Aligned region: 589..722
RuvB_N [PF05496], Evalue: 0.0041, Aligned region: 212..229
RuvB_N [PF05496], Evalue: 0.0041, Aligned region: 547..613
RuvB_N [PF05496], Evalue: 0.0041, Aligned region: 660..686
AAA_30 [PF13604], Evalue: 0.0051, Aligned region: 210..230
AAA_30 [PF13604], Evalue: 0.0051, Aligned region: 587..622
DUF258 [PF03193], Evalue: 0.0063, Aligned region: 209..231
DUF258 [PF03193], Evalue: 0.0063, Aligned region: 575..603
PhoH [PF02562], Evalue: 0.0081, Aligned region: 205..235
PhoH [PF02562], Evalue: 0.0081, Aligned region: 583..619
Protein Sequence: 855 a.a.     [Download]
>gi|549688977|ref|YP_008620709.1| Chaperone protein clpB [Vibrio nigripulchritudo]
MTSLSLAALVERLTPDAKASLEQAAALASSRTHHSIEMTHWLITILQQQGTVIQTVSEEFGLNVFKLEDD
IQNSLEKLKTGCQTVPGLSAHTVTILKSAWMVSNIEFSDEQIDVIHLLYALLNDDTLFAVTSAFGQELDK
ISPEALLHFWHSADRKTQQAAPAQKASTKALDQFTIDLTDQAKAGEIDPVVGRDNEIRLMIDILLRRRQN
NPILTGEAGVGKTAVVEGLALKVVQGDVPPALQGVSIKSLDLALLQAGAGMKGEFENRLKSVVKEVNDSP
TPIIMFIDEAHGLIGSGGQAGQSDAANILKPALARGELRTIAATTWAEYKKYVEKDAALTRRFQVVQVEE
PAPELAVEMLRGLVPVMEGHHGVHITNEALKAAVYLSDRYIHGRQLPDKAVSVLDTACSRVALSQSAMPG
QLEALEKTLEQKVAQIEQLEKEQALGHSHTDVLAALSSESDELKAEISELKSVWEKESELVSQSKQLKTE
VLEDKVKGALEKLVEVEATLAENKTPLVFSHVNEALVSEIVSDWTGIPLGKLQNDEINSLLTLKEKLCER
VVGQDHALHTMSEVIKTARAQLNEETKPNGIFFLTGPSGVGKTESALAIAEQVYGSEDNVTVINMSEFKE
EHKVSLLLGSPPGYVGYGEGGVLTEAVRRKPYSVILLDEMEKAHPGVQDVFYQVFDKGTIKDGEGRDIDF
RNTIIIMTSNAGTDTTMELFQDPELAPDIDGLRTALRDDLLASFKPAFLGRVNVIPYVPLNRDVLTEIAK
IQLNKIGKRLAANYSAEFEYSDELVGALIDNCNEEGSGARAIQTIIQNSLLPKISDEVLIAISEDESINK
LVIKGELNNISISIK
 
Nucleotide Sequence: 2568 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1542592-1545159 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGACATCACTATCTTTAGCTGCACTAGTGGAGAGGCTAACTCCAGATGCAAAAGCATCACTAGAGCAGG
CAGCGGCACTGGCGAGTAGCCGAACTCACCACAGTATTGAAATGACCCACTGGTTAATTACTATCTTGCA
ACAGCAAGGTACGGTAATTCAGACGGTGTCTGAAGAGTTTGGATTGAACGTATTCAAGCTTGAAGATGAT
ATTCAAAACAGCTTAGAGAAACTGAAAACAGGCTGCCAGACTGTACCAGGCTTGTCAGCGCATACAGTGA
CTATTCTGAAGAGTGCTTGGATGGTGTCCAACATCGAGTTTTCAGATGAACAGATTGATGTAATTCACCT
GTTATATGCGCTGTTAAACGACGATACGTTGTTTGCTGTTACCTCTGCCTTTGGTCAGGAACTCGATAAA
ATTAGCCCCGAAGCTTTGCTGCATTTCTGGCACAGCGCCGATCGCAAGACTCAGCAAGCTGCGCCAGCGC
AAAAAGCGTCGACTAAGGCACTTGACCAGTTCACCATTGACCTGACAGATCAAGCAAAGGCAGGTGAAAT
CGATCCAGTTGTAGGTCGAGATAATGAGATTCGCCTGATGATCGACATCTTGTTAAGACGCCGTCAGAAC
AACCCGATTCTGACAGGCGAAGCAGGTGTAGGTAAAACAGCTGTAGTTGAAGGTTTGGCGTTAAAAGTGG
TTCAGGGAGATGTACCACCTGCGCTACAAGGGGTTTCAATTAAGTCTCTGGATCTGGCTTTGCTTCAGGC
CGGTGCAGGCATGAAAGGTGAATTTGAAAACCGACTTAAGTCCGTGGTCAAAGAAGTGAACGATTCGCCT
ACACCTATTATTATGTTTATCGACGAAGCACATGGCTTAATCGGAAGTGGTGGTCAGGCAGGGCAAAGTG
ATGCTGCAAACATTCTCAAACCAGCCTTAGCTCGTGGAGAGCTACGTACTATTGCCGCGACTACATGGGC
AGAATACAAAAAATACGTAGAGAAAGACGCCGCTTTAACTCGTCGATTCCAGGTTGTTCAAGTTGAAGAG
CCAGCTCCAGAACTCGCAGTGGAAATGCTTCGTGGGTTAGTTCCTGTAATGGAAGGTCACCACGGTGTCC
ACATTACCAATGAAGCATTAAAAGCAGCTGTTTATCTATCAGACCGATACATTCATGGTCGCCAACTTCC
GGACAAAGCCGTGTCTGTTTTAGATACTGCCTGTTCCCGTGTAGCGCTTAGCCAGTCGGCAATGCCTGGG
CAGCTAGAAGCTCTTGAAAAAACGCTCGAACAAAAAGTTGCTCAAATTGAGCAGTTGGAAAAAGAGCAGG
CTCTAGGTCATTCGCATACTGATGTACTTGCCGCTTTAAGCAGTGAAAGTGATGAGTTAAAAGCGGAGAT
TTCTGAGCTTAAATCAGTTTGGGAAAAAGAATCTGAGTTAGTTAGCCAGTCTAAGCAATTAAAAACAGAA
GTTCTGGAAGACAAAGTCAAAGGTGCCTTAGAAAAGCTGGTTGAAGTCGAAGCGACGCTAGCAGAAAACA
AGACGCCACTTGTATTCTCACACGTTAATGAGGCGTTAGTTTCTGAAATCGTATCAGACTGGACAGGTAT
TCCACTTGGCAAACTTCAGAATGATGAGATAAACAGTCTTCTGACATTAAAAGAGAAGTTATGCGAAAGG
GTTGTCGGTCAAGATCACGCTTTGCATACTATGTCTGAAGTCATTAAGACTGCTCGCGCCCAGCTTAACG
AAGAAACCAAGCCTAATGGCATTTTCTTCCTGACCGGACCGAGTGGTGTCGGTAAGACGGAATCTGCGCT
GGCAATCGCAGAGCAGGTTTATGGCAGCGAAGATAACGTAACGGTTATCAACATGTCGGAATTTAAAGAG
GAGCACAAAGTTTCTCTGCTTCTAGGCTCCCCTCCAGGCTACGTAGGGTACGGTGAAGGTGGTGTTCTGA
CTGAGGCTGTCAGAAGAAAGCCATACAGCGTTATTTTGCTTGATGAGATGGAAAAAGCTCACCCTGGGGT
TCAGGACGTGTTCTATCAAGTCTTTGATAAAGGAACCATAAAAGATGGTGAAGGGCGCGACATTGATTTT
CGCAACACCATTATCATCATGACTTCGAACGCTGGTACCGATACCACTATGGAGCTGTTCCAGGATCCTG
AGCTCGCCCCAGATATTGATGGGTTGAGAACCGCTTTGCGTGATGACTTGCTAGCAAGCTTCAAACCTGC
ATTCCTCGGCCGAGTTAATGTGATTCCATATGTGCCTCTAAATCGTGATGTTCTGACTGAAATCGCGAAA
ATACAGCTGAACAAAATTGGTAAGCGCCTGGCAGCTAATTACAGCGCAGAGTTTGAATATTCTGATGAGC
TCGTAGGTGCACTTATCGACAATTGTAATGAAGAGGGTAGTGGCGCTCGAGCAATACAGACAATTATTCA
AAATAGCCTACTACCTAAGATTTCAGATGAGGTGCTTATCGCTATATCGGAAGATGAATCTATTAATAAA
TTAGTTATTAAAGGCGAGCTGAATAATATATCTATCAGTATTAAATAA
 Primer design