SecReT6
Protein ID: 549688979
SecReT6 ID855
T6SS typei5
Gene symbol-
Locus tagVIBNI_A1444
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1545917..1547728 [+]
Productputative VgrG protein
NoteTssI
UniProt IDU4K4Q6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-59, Aligned region: 31..336
Phage_base_V [PF04717], Evalue: 2.60E-27, Aligned region: 377..470
Protein Sequence: 603 a.a.     [Download]
>gi|549688979|ref|YP_008620711.1| putative VgrG protein [Vibrio nigripulchritudo]
MKKATQSNNFIKISTAFGYDSIILNSFQYYEGLSELFSLQALAYFNGTQGDLSQVIGKPAVILMDNNALV
TEDPRYFHGVVTNARILGSRVTSGHEGENYKDIELTIRPRLALCEFRKNNRIFQNKDVKEIISLILGEHA
VEFALKLNKTYPKYTFKVQYNESDLEFILRLLSEEGISFSFVHEESGHKLELFDDLSFYQPSTEAAISHS
TGSSEFAHVSSWQETQSITTKASCLSGFDMLKPNSLPSHNVQMKPASYTPPMSEYYEYMGEEETGDKYAY
KNQHILESLQRESQIFSGTASCRTFTTGQTFKFDAHEDKAFVGKEFVLTHVSVNASVFNQTGSHGNAGQG
VEVQFYCMDVKKLFRPPLPKAKPRIQGIQTAIVTGPSEGDIHVDKHGRIKVQFHWDREGKRDAQSSCWIR
VAQQSAGNGWGSTFLPRVGQEVIVEFVNGDPDQPIVMGVLYNGANATPYALPDKKTQSGIKSRSVKGGAS
NFNEVRFEDKPGKELLYLHAEKDYQSVVENNADILVENDKVQTVTNNEAHNVGKNLSVDVGEILSLTAGK
SIELKVGGASITMSSSGEINIKGNQVAINGSAIDLKAGKIALN
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1545917-1547728 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGAAAAAAGCGACACAAAGTAATAACTTTATAAAGATCTCTACAGCATTTGGGTATGACTCCATTATTC
TGAATAGCTTCCAATACTACGAAGGACTTTCAGAACTTTTCTCACTACAAGCTTTAGCCTATTTCAATGG
CACTCAAGGGGATTTATCCCAAGTTATCGGCAAGCCAGCAGTTATTCTTATGGATAACAACGCACTTGTT
ACTGAAGACCCAAGGTATTTTCATGGTGTGGTTACCAATGCTCGTATTTTAGGCAGCCGAGTTACTTCTG
GGCACGAAGGTGAAAATTATAAAGATATCGAACTTACAATTCGTCCAAGACTGGCACTTTGTGAGTTTCG
GAAAAATAATCGAATTTTCCAAAATAAAGATGTAAAAGAAATAATTTCATTAATATTAGGCGAACATGCT
GTAGAGTTTGCACTGAAATTAAATAAAACCTATCCAAAATATACATTCAAAGTTCAATATAACGAAAGTG
ATCTTGAATTTATTCTAAGACTTTTATCAGAAGAAGGTATTAGTTTTAGTTTTGTCCATGAAGAATCTGG
TCACAAGCTAGAGTTATTTGATGATTTAAGTTTCTACCAACCTAGTACTGAAGCGGCTATTTCTCATAGC
ACTGGCAGTTCAGAATTCGCACATGTTTCTTCTTGGCAGGAAACCCAATCGATCACGACAAAAGCGAGTT
GTTTGTCCGGCTTTGATATGTTGAAGCCGAATAGTCTTCCTAGTCATAACGTTCAGATGAAGCCTGCCTC
TTACACACCTCCAATGAGTGAATACTACGAATACATGGGGGAAGAGGAAACTGGCGATAAGTATGCTTAC
AAGAACCAGCACATTCTCGAATCGCTTCAACGTGAAAGCCAAATTTTTTCAGGTACGGCAAGTTGTCGTA
CTTTTACCACGGGCCAAACGTTTAAGTTTGATGCCCATGAAGACAAGGCGTTTGTCGGCAAAGAATTTGT
TCTGACCCACGTCTCTGTGAATGCTTCGGTGTTTAACCAGACAGGTAGTCATGGAAATGCAGGGCAGGGA
GTAGAAGTACAATTCTACTGTATGGATGTGAAAAAGCTTTTCCGTCCACCGCTGCCTAAAGCGAAGCCTA
GAATCCAAGGTATTCAGACCGCCATAGTAACGGGTCCGAGTGAAGGCGATATTCACGTTGATAAGCATGG
TCGAATAAAGGTCCAGTTCCACTGGGATCGTGAAGGTAAACGAGACGCACAAAGCTCTTGCTGGATCCGT
GTCGCGCAGCAGAGCGCGGGTAACGGATGGGGAAGTACTTTCCTTCCTCGTGTAGGGCAGGAAGTGATCG
TCGAGTTTGTTAACGGCGATCCTGATCAACCGATTGTTATGGGTGTGCTTTACAACGGTGCTAATGCGAC
CCCATATGCTCTGCCCGACAAGAAAACGCAAAGTGGTATCAAGAGTCGCTCTGTAAAAGGAGGTGCTAGC
AACTTTAATGAGGTGCGCTTTGAAGACAAGCCAGGAAAAGAGCTTTTGTATCTTCACGCAGAGAAAGACT
ATCAATCGGTTGTGGAAAACAACGCAGACATACTTGTTGAAAACGACAAAGTACAAACAGTCACCAACAA
TGAAGCACATAACGTCGGTAAGAATTTAAGTGTCGATGTTGGTGAAATTCTCTCTCTTACCGCAGGAAAA
AGCATTGAACTAAAGGTTGGTGGCGCGTCCATCACTATGTCGAGTTCTGGTGAAATAAACATCAAAGGCA
ACCAAGTCGCCATAAACGGATCAGCGATAGATTTGAAAGCCGGAAAGATCGCTCTGAACTAA
 Primer design