SecReT6
Protein ID: 549718602
SecReT6 ID856
T6SS typei1
Gene symbol-
Locus tagVIBNI_B0350
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]384556..388101 [+]
Productputative Type VI secretion system, IcmF
NoteTssM
UniProt IDU4KI66
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.40E-87, Aligned region: 241..265
IcmF-related [PF06761], Evalue: 5.40E-87, Aligned region: 510..825
ImcF-related_N [PF14331], Evalue: 6.40E-80, Aligned region: 199..462
DUF1215 [PF06744], Evalue: 2.20E-36, Aligned region: 588..609
DUF1215 [PF06744], Evalue: 2.20E-36, Aligned region: 852..875
DUF1215 [PF06744], Evalue: 2.20E-36, Aligned region: 918..1039
Protein Sequence: 1181 a.a.     [Download]
>gi|549718602|ref|YP_008641235.1| putative Type VI secretion system, IcmF [Vibrio nigripulchritudo]
MGKFISGLLKKMGQSFKSAIPILLVALCVLIIVAIWWAGPMLEYQETFPLSSVMSRVIASVIFSLICIAF
WGMYQWKALNRFKASIKREEQLKADPILQFEERQEVELNQIMVNMKENLNKRNYLYALPWYLVIGLENAG
KTSLINRSGQNFVFSTVMRASGKKSENPYSFDWWIGEESVLIDPDGELLTQGYNNEDNDGQMERRLWMHF
IEWLERTRSRRPLNGVVIALDVAQLASGTTSSRKAYASLLRTRLRELMETLSTRMPVYVTLTKMDLLHGF
EPFFRHYPKSKRDEVLGFTFSLDSVDNLDKWLDEFTEDYGRFVERIKESLPLSLLETMDNSERQSIYGFT
RQISGLKEVLHEFLQDALGSDQFSTSALVRGVYFTSVFQQGVPSNAFDDAASRRYGLSHAINRAQDAKNS
TVYFTQKLFNGIVYPEAGLASDNFRVAKQKRRIVALSTVVCLIATFMLIGSWHGYYIKNVNQADAVLAKV
NEFRNKYPEDLSLLNQKEILEPLDTIREATLEFGFFREKPEYISDMGLYQGHMIGPKVEQTYLALLESRY
LPSLMKDIALELSNAENEEHQLEVLRVFRMMIDKSGRYKEFVMDYFSKNWQRQFVGNRVTQERLLEHLDY
AMNHTDLATQYKEGDQAAIASVKPYEGLISKAQRDLSAMSIEQRVYRNLKSNSSTYLGAPINVRNQVGPV
FDVVFEERVIDSENLMVPRMLTKQGFDSYFIEQSDSVSELALIDSWVLGQTQVAEFSAADKIALKNKIRS
LYVVDYTNTWRNAMNEVDVKYFVDINNAVLVLDNLTGSTQPFTRLLQTLEDNTRLFSELPENEEAREELL
KSPKYKVASMIHAPFAELNSMLHAQGAQPAYFDEVQTAVVQLLNYLKAIQDAPDVGRAALEATKARISLS
NADPIYTLKRIASGLPSPLDNMVSKIADESWYVVKQEAIKHLEIRWQRDVYSVFQEKFASRYPFDQESRK
DVALEDFEEFFSPDGTLDSFYSEQLKMFIEEGISISEDSAQQSLIRPEVLAQLKQAKKIQRAFFNRKGIL
DVAFSLEPIRLTSNKRRSVINIDGQYVEYSHGPRQSVELIWPNTLRGSSVSKVTLVPTKSNLSPRSIERK
GPWALFRLLDKSEVVGGSITSVDYKFAIDRGDVSYRLYSEAAVNPFKERLFDSFKLSSTLY
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|549718281|ref|NC_022543.1|:384556-388101 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGGGGAAGTTTATCAGCGGCTTGCTTAAAAAAATGGGTCAGAGCTTCAAATCGGCCATTCCGATTTTGC
TGGTCGCGCTGTGTGTGCTGATCATCGTCGCCATCTGGTGGGCAGGTCCGATGCTGGAATATCAGGAGAC
ATTCCCATTGTCTTCCGTGATGTCTCGCGTGATTGCGAGTGTGATTTTCTCGCTTATCTGTATTGCCTTC
TGGGGTATGTATCAGTGGAAAGCGCTGAACCGCTTTAAAGCCAGCATCAAGCGAGAAGAACAGCTAAAAG
CGGACCCAATTCTTCAGTTTGAAGAACGTCAGGAAGTTGAGTTGAACCAGATCATGGTCAACATGAAGGA
GAACCTCAACAAGCGCAATTACCTTTACGCCCTGCCCTGGTATTTGGTGATTGGTCTGGAAAATGCAGGT
AAAACCAGCCTTATCAACCGTTCCGGTCAGAATTTTGTGTTCTCTACCGTGATGCGCGCATCGGGTAAGA
AAAGCGAAAACCCTTACAGTTTCGACTGGTGGATTGGCGAAGAGTCGGTGCTGATTGACCCTGATGGCGA
ACTGCTGACTCAAGGCTACAACAACGAAGACAACGACGGCCAGATGGAACGTCGTCTATGGATGCACTTC
ATCGAATGGCTTGAGCGCACCAGAAGCCGTCGCCCTTTGAACGGCGTGGTGATTGCCCTGGATGTCGCGC
AATTAGCCTCTGGTACAACTTCCAGCCGAAAGGCTTACGCCAGCCTACTCCGCACCCGTTTACGCGAGCT
GATGGAAACCTTGTCTACGCGTATGCCAGTGTATGTCACGTTAACGAAAATGGACTTGCTACACGGCTTC
GAACCTTTCTTCCGTCATTACCCAAAGAGCAAACGTGATGAAGTGTTGGGCTTCACCTTCTCACTGGATT
CAGTCGACAATCTCGACAAATGGCTGGATGAGTTCACCGAAGATTACGGTCGATTTGTTGAGCGCATTAA
AGAGAGTTTGCCACTGTCGCTGCTGGAAACCATGGACAACTCTGAGCGTCAGAGCATCTATGGCTTTACA
CGCCAGATCTCGGGTCTGAAAGAAGTGCTGCATGAATTCCTGCAAGATGCATTGGGCAGCGATCAGTTCT
CGACGTCGGCTCTGGTCCGTGGTGTTTACTTTACTTCTGTATTCCAGCAGGGCGTGCCTTCCAATGCCTT
TGATGATGCGGCATCGCGCCGTTACGGTCTGAGCCACGCAATTAATCGAGCGCAGGACGCGAAAAACTCC
ACGGTTTACTTCACCCAGAAACTGTTCAACGGAATTGTGTACCCAGAGGCGGGCTTGGCGTCGGACAACT
TCCGCGTAGCCAAGCAGAAACGCCGCATTGTGGCGTTGTCGACGGTGGTGTGCCTTATCGCTACCTTTAT
GTTGATCGGCAGCTGGCACGGGTACTACATCAAGAACGTCAATCAGGCAGATGCGGTACTGGCTAAGGTG
AATGAATTCCGCAACAAGTATCCGGAAGATCTCTCTTTACTGAATCAGAAAGAGATTCTGGAACCGCTGG
ACACCATTCGTGAAGCCACACTGGAGTTCGGTTTCTTCCGTGAAAAACCAGAATACATTTCGGATATGGG
CTTGTATCAAGGACACATGATTGGTCCAAAAGTTGAGCAGACATATCTGGCTTTGCTGGAAAGTCGTTAT
TTACCGTCTTTGATGAAAGACATCGCACTGGAGTTGTCGAACGCGGAAAACGAAGAGCATCAGTTGGAAG
TACTGCGCGTGTTCCGAATGATGATCGACAAGAGCGGTCGTTACAAAGAGTTCGTTATGGATTACTTCTC
TAAAAACTGGCAGCGACAGTTTGTAGGGAACCGCGTCACTCAAGAACGTTTGTTAGAACACCTCGATTAC
GCCATGAACCACACCGATTTGGCGACTCAGTACAAAGAAGGTGATCAGGCTGCAATTGCCTCGGTGAAAC
CTTACGAGGGGCTGATTTCTAAGGCGCAGCGTGATTTAAGTGCAATGTCCATAGAGCAGCGTGTATATCG
TAACCTGAAATCCAACTCTTCAACCTACCTTGGTGCGCCCATCAATGTGCGAAATCAGGTGGGGCCGGTA
TTTGATGTGGTGTTTGAAGAGCGTGTCATCGACAGTGAAAATCTGATGGTGCCGCGCATGCTGACCAAGC
AAGGTTTTGATAGCTACTTTATTGAGCAGTCGGATTCGGTTTCTGAACTGGCGTTAATAGACAGCTGGGT
ATTGGGGCAAACACAAGTGGCGGAATTCAGCGCTGCAGACAAGATTGCCCTGAAGAACAAGATCCGCTCG
CTCTACGTAGTCGATTACACCAACACATGGCGAAACGCGATGAACGAAGTGGATGTGAAGTACTTCGTCG
ACATCAACAACGCCGTTTTGGTGCTGGATAACCTGACGGGCAGCACTCAGCCATTCACCCGCTTGCTTCA
AACCCTTGAAGACAACACCCGCTTGTTCAGTGAGTTACCAGAAAATGAAGAAGCGCGTGAAGAGTTGCTG
AAATCACCAAAGTACAAAGTTGCGTCCATGATTCATGCGCCGTTTGCAGAGCTGAATTCCATGCTGCATG
CGCAAGGGGCGCAACCAGCGTACTTCGATGAAGTACAGACAGCGGTAGTGCAACTGCTGAACTACCTGAA
AGCGATTCAGGATGCACCAGACGTGGGGCGTGCTGCGCTGGAAGCAACCAAAGCGCGAATCAGCCTGAGC
AACGCTGACCCAATCTACACGCTAAAACGCATCGCCTCTGGCTTGCCAAGCCCGCTCGACAACATGGTGT
CTAAAATCGCCGACGAGAGCTGGTACGTGGTGAAGCAGGAAGCCATTAAGCACCTGGAGATCCGCTGGCA
GCGTGACGTGTATTCGGTGTTCCAGGAGAAATTTGCCTCCCGTTATCCGTTCGACCAAGAGTCGCGTAAA
GACGTGGCACTGGAAGACTTTGAAGAATTCTTCTCGCCAGACGGCACCTTGGACAGCTTCTACAGCGAGC
AGTTGAAGATGTTCATCGAAGAAGGGATCTCCATTTCTGAAGATTCGGCGCAGCAATCGTTGATTCGCCC
TGAAGTACTCGCGCAGCTTAAACAGGCTAAGAAGATCCAACGTGCCTTCTTTAACCGCAAAGGGATTCTG
GATGTGGCGTTCTCTCTTGAGCCGATTCGCCTGACGTCTAACAAGCGTCGCTCAGTGATCAACATTGATG
GTCAGTATGTGGAATACAGCCACGGTCCTCGCCAGTCGGTGGAGTTGATTTGGCCAAACACCTTACGTGG
AAGCTCGGTGTCGAAAGTGACGTTAGTGCCAACCAAGTCGAACTTGTCGCCTCGCAGTATCGAGCGTAAA
GGCCCTTGGGCGCTGTTCCGACTGCTTGATAAGAGTGAAGTGGTAGGAGGCAGCATCACCAGCGTGGATT
ACAAATTTGCGATCGATCGCGGTGATGTGTCTTACCGCTTGTATTCCGAAGCGGCGGTGAATCCGTTTAA
AGAACGTCTGTTCGATTCGTTCAAACTGTCGAGCACTCTGTACTAG
 Primer design