SecReT6
Protein ID: 549723003
SecReT6 ID857
T6SS typei3
Gene symbolsciS
Locus tagSTMDT2_02811
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. DT2
Repliconchromosome [GenBank: NC_022544] [Browse all T6SS(s) in this replicon]
Location [Strand]323835..327704 [+]
Productprobable IcmF-related integral membrane ATP-binding protein, virulence associated protein
NoteTssM
UniProt IDU4MHG3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.00E-93, Aligned region: 588..916
ImcF-related_N [PF14331], Evalue: 2.90E-92, Aligned region: 263..541
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 446..482
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 1025..1146
Protein Sequence: 1289 a.a.     [Download]
>gi|549723003|ref|YP_008643193.1| probable IcmF-related integral membrane ATP-binding protein, virulence associated protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT2]
MQKFLSLLFSRRALAVVGVLVLALLVWFVGPLVSFDTLRPLASVGSRVVTIALLLMLLVLWLVNWSMSII
GISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLIGFILLMYALYGLYRLWRALRMDEQLLRRFLHPRGEE
VPVAGEIKADLRTVNHIVTQAIRQLRQLRVDMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGL
QFPLAEQMEQTSRILTVPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRK
HRPGAPLNGVILTLNVADLTAQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDLLPGFSEYFRT
LTSHLRAQIWGFTLPYSRRRKAGDPQALHAACAQELARLTLRLDQGLDTRLQEEYDLKSRQRLYTFPREF
AALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAAQAQADAVADQLSIWQRFVRAIKTARGESSASL
PHALPDGNRSYFLHDLLTQFIFREAHLVEPNLQWAWRYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDY
LNEISARATRLDGDVKAYTGKPAMAPVPALLDSARELSAWPELDPDAPPLAWRYGLYSVPPVTDSVASLY
NRLLDQLLLPPLVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVINDLGNSDS
VAGFGGRAAVLTHIEALFDGSRVVHSPYEKDEALIRQARAFLDGHSSTERIYARALAAMESEAPQEFTLV
RAVGADAGTVFVRSNGAPLDRGVPGIFTREGYRELFDKRLPEFVAAATANDGWVMGRESTPKKLTDSLRS
QIPGQEQSVAREVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLGKAV
VEQTTLVPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVIAGRTDGGQ
SGGGTMQIASLLTMLNEYYTQLTIADSALAAGTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGTRKI
NAGTGDVLNTQMEAMMGDDCRDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTASDP
WRYKPTEGNMTLQGPDLTPFQQAKQIRSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRYAH
GPDRPLKVTWPGPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRR
VVLEITAGRDFNPVSRELLQNFSCPARAL
 
Nucleotide Sequence: 3870 bp     [Download]
>gi|549722728|ref|NC_022544.1|:323835-327704 Salmonella enterica subsp. enterica serovar Typhimurium str. DT2, complete genome
ATGCAAAAATTTCTTAGTCTGCTTTTTTCCCGGCGCGCGCTGGCAGTTGTGGGCGTTCTGGTTCTGGCGC
TGCTGGTCTGGTTTGTCGGGCCGCTGGTGTCATTTGATACCCTGCGCCCGCTGGCCTCCGTGGGTAGCCG
GGTAGTGACCATTGCCCTGTTGCTGATGCTGCTGGTACTGTGGCTGGTCAACTGGTCGATGAGTATCATC
GGCATCAGTGTCCTGTGCCTGGCGATTGGCTTCGTCACACCGCTGCTGGCCCTGGGCGATGTCCATCCGT
TTGCGCCGCTGTGGGTCCGCCTGACCCTGATTGGTTTCATCCTGCTGATGTACGCGCTGTACGGCCTGTA
CCGGCTGTGGCGTGCGCTGCGTATGGATGAACAACTGCTGCGTCGCTTCCTGCATCCGCGCGGGGAAGAG
GTACCGGTGGCAGGCGAGATCAAAGCCGACCTGCGCACCGTCAACCATATTGTCACGCAGGCCATCCGGC
AGCTGCGGCAGTTGCGGGTGGATATGCCTGGCTGGCGTAAAATCTTCGAGGGAAAACGCTTTCTGTATGA
GCTGCCGTGGTTCATGGTGGTCGGCAGTCCCGGCGACGGCAAAACCACGGCCCTGCTGAACACCGGATTG
CAGTTCCCGCTGGCGGAGCAAATGGAGCAGACTTCGCGCATCCTGACAGTACCGGGTGGCGGCACGCTAC
ACTGCGACTGGTGGTTTACCAACGAAGCGGTGTTGATTGATACCGCCGGACGCTACGCCCGCCACGATGA
CGGTGGTGAAGCGAGCGCCGCGCAGCGTAACGCCGGAGAGTGGCAGGGCTTTCTCGGTCTGCTGCGTAAA
CATCGCCCCGGCGCGCCGCTTAACGGCGTGATCCTGACGCTAAACGTGGCGGATTTAACCGCACAGTCAC
CGGCGGAACGCCTGGCGGCCTGCGCCGCTCTGCGGGCGCGACTGGCAGAACTGCGCGAGACCCTGGGGAT
TCGCTTTCCGGTCTATCTGGTGGTCACCAAAATGGATTTGTTGCCGGGGTTCAGCGAATATTTTCGCACG
CTGACCAGCCATCTTCGTGCACAAATCTGGGGCTTCACGTTGCCGTACAGCCGCAGGCGAAAAGCGGGCG
ACCCGCAGGCGCTGCACGCCGCCTGCGCGCAGGAGCTGGCGCGCCTGACGCTGCGGTTGGATCAGGGACT
GGATACCCGGTTACAGGAAGAGTACGACCTTAAAAGCCGCCAGCGGCTGTATACCTTCCCGCGTGAGTTC
GCCGCCCTCGGCGAGCCGTTGCTGGAGGCTATTGAACAGATCTTCCTCGATTCAAAATTCGATGCCACGC
AACTGAATAACACGCTGCGCGGGGTGTTTTTCACCAGCGCCGCGCAGGCGCAGGCCGACGCCGTGGCCGA
CCAGTTGAGTATCTGGCAGCGCTTTGTCCGGGCGATAAAAACCGCCCGTGGCGAATCCTCCGCCTCTCTC
CCACACGCTCTGCCGGACGGCAACCGCAGCTACTTCCTGCATGACCTGCTGACACAGTTTATTTTTCGTG
AAGCGCACCTGGTGGAGCCAAACCTCCAGTGGGCCTGGCGTTACCGCCTGCTGCGCCTCGGCGGGCACCT
GCTGGTACTGGTGCTGGCATTCCTGTTGTGGCAGGGGATGCAGACCAGCCAGCAGACCAACGGCGACTAT
CTGAATGAAATCAGCGCCCGCGCGACCCGGCTGGACGGTGATGTGAAAGCCTACACCGGTAAACCGGCGA
TGGCTCCCGTCCCGGCACTGCTGGACAGCGCAAGGGAACTGTCCGCCTGGCCGGAACTGGACCCGGACGC
GCCGCCGCTGGCCTGGCGCTACGGTCTGTACAGCGTACCGCCGGTAACCGACAGCGTGGCGTCGCTGTAC
AACCGTCTGCTGGATCAACTGCTGCTGCCGCCGCTGGTGAAACGGATGGAGTATGTGCTGGCGGACGCCA
TTGCCCGTCAGGATAGTAAAGCGGCCTACGATGCCCTGCGCATCTATCTGCTACTGAATCTGGATAAAGA
TCACGAAGATAAATACAACGCGGCGGAGATCCAGTCGTGGGTGATTAACGATCTGGGGAACAGCGACAGC
GTGGCCGGGTTCGGCGGGCGCGCCGCCGTGCTGACGCATATCGAAGCGCTGTTTGACGGCAGCCGGGTGG
TGCATTCACCGTATGAGAAAGATGAGGCGCTGATCCGCCAGGCGCGGGCATTCCTCGACGGTCACAGCAG
TACCGAGCGTATCTACGCGCGGGCGCTGGCGGCAATGGAGAGCGAAGCGCCGCAGGAGTTCACGCTGGTA
CGCGCCGTCGGCGCGGATGCGGGAACGGTCTTTGTGCGTAGCAACGGCGCGCCGCTGGATCGGGGCGTGC
CGGGTATTTTTACCCGTGAAGGATACCGGGAGCTGTTCGACAAACGATTACCGGAATTTGTGGCGGCGGC
GACGGCGAACGATGGCTGGGTGATGGGCCGGGAGAGTACGCCAAAAAAGCTGACTGACAGCCTGCGCAGC
CAGATACCGGGGCAGGAGCAGTCTGTCGCCCGCGAAGTCCGCCGTTTGTACCTGACGGAATATGCCCGCC
GCTGGCAGGATTTTCTGGACAGTATCCATAGTATCAACAGTGCCGGGGAAGAGGGCAGTTCCGGCCTGGC
CTATGATTTACAGGTGCTGCGCACCCTGGCGTCGCCGGACTCACCGCTGATGCGGCTGGGAAAAGCGGTG
GTGGAGCAGACCACGCTGGTGCCGCCGCCGGACCCGCAGGCCAGACAGAAACAACTGGCGCAGCGCGCAT
CCGGTAACGCGGGGAAAGTGGTACAGACGGCAAAACTGTTCCAGGATATTCACCCGGAAGAACGGCTGGA
AAAAACGCTGGTGGATGATCGTTTCGCCGCGCTGCGCGAGGTCATTGCCGGGCGGACGGACGGCGGACAG
AGCGGCGGTGGGACGATGCAGATCGCTTCGCTGCTGACCATGCTCAACGAGTATTACACCCAACTGACCA
TTGCTGATAGCGCGCTGGCGGCGGGGACGTTGCCAGCGCGCATTACTGCCGCAGACAAGTTGCAACTGGA
GGCGGCGAAACTGCCCGCGCCGCTGAAAAACATCCTGCTGGATCTGACGAAGCAGGGAACGCGCAAAATC
AACGCCGGGACCGGCGACGTGCTGAACACCCAGATGGAGGCGATGATGGGCGACGACTGCCGTGACGCCA
TCGACGGGCGCTATCCGTTCGCCGACAGTCCGCAGGAGGTCAGCGCCGAGGACTTTAACCGCATCTTCGC
CAGCGGCGGCGTACTGGATGCTTTCTGGAGCAAACAACTGGCTCCGCTGGCGGACACCGCCAGCGACCCG
TGGCGCTACAAACCGACCGAAGGCAACATGACATTGCAGGGGCCGGATCTGACGCCGTTTCAGCAGGCGA
AGCAGATCCGCAGCGTATTTTTTAACAGCGAGGGCGGGAAAAAATTTTCCTGGTCGATGCAGATTAGCGT
GGTGGATATGGACCCGGCCATCACGGAACTGGTGATTGATATCGACGGCCAGGTGCTGCGCTACGCCCAT
GGTCCGGACCGTCCCCTGAAAGTAACGTGGCCGGGACCGCGCAACGGCTCGATGGCGGAAATCACCGCCA
GCCCGCGTATTCGCCAGGACACCTCAACGCTACTGACCGGCGGGCCGTGGGCGCTGTTTCATCTGCTGGA
CGCCGGAATGGTACAGGAAACGGCGGTGCGGGGGCGTCAACTGGTGGAATATGATTTTGACGGTCGCCGG
GTGGTGCTGGAAATCACCGCCGGGCGGGATTTTAACCCGGTCAGCCGGGAGCTGTTGCAGAACTTCAGTT
GCCCGGCGAGGGCGCTGTAA
 Primer design