SecReT6
Protein ID: 550444351
SecReT6 ID858
T6SS typei2
Gene symbol-
Locus tagD364_06940
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]1472518..1475946 [+]
Producttype VI secretion protein VasK
NoteTssM
UniProt IDU5MD46
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.10E-70, Aligned region: 416..734
DUF1215 [PF06744], Evalue: 2.90E-33, Aligned region: 251..298
DUF1215 [PF06744], Evalue: 2.90E-33, Aligned region: 857..977
Protein Sequence: 1142 a.a.     [Download]
>gi|550444351|ref|YP_008659929.1| type VI secretion protein VasK [Klebsiella pneumoniae CG43]
MDNVNKPVAISVAATVIVCIAAVTLLVLLGGLAWWLWAMDRATQWETLRPLIATGFIIWGMALSLLVLGF
MAFRLLIKDKVKPSAAPVRQPTRPAGREALYAPLKKYLHARYRLRWRRKVRLLLVTGDDAAIEQLVPGLR
QQHWLEGNRTVLIYGGSLASEPDREKYIALRKLRRGRPLDGIVRVMPSSLTLTPLISESDLHGLEKISEL
LGYAAPVWLWKLCDSEWPQADRAVQAVGVSFPLRATEDDVARQLAQMLPTLREQGMRQIAEETRHDFLLR
LGQQLIDGEIAQWRRQLAPWLTASRQRLALRGLMFSLPEPRAVDPYQEADTSPASQPHLLTLPATWQGIV
DDCRRLRGHHVGMAWERGLACGLLAILGLWAAGLLLSFALNYSQIASVAGKARDLVAHPSVSDYQLTALH
ALRNEAGRLVHDGQKGAPWYRRFGLDHHQQLLNAVLPWYGVANHRLIRDPANAALQQALNALVNSAPNSD
QRARLAKPGYDQLKAWLMMARPDKADGAFFAQTMKTVQPTRMGISTGLWQSLAPDLWAFYLSLLPERPEW
KIIPDAQRVSQSRQVLLQQLGRRNAESTLYENMLKSVRRNFADVSLEDMTSGTDARRLFTTDEVVPGMFT
RQAWEGGIQQAIDKVASSRREEIDWVLSDSRKTVSTDLSPEALKARLTRRYFTDFAGSWLNFLNSLRLNP
ATNIADVTDQLTLISDVRQSPLIALMNTLAWQGQAGQQREGLSDSLIKSAKDLVGGKDKPVIDQSAAGPQ
GPLDDTFGPLLQLMGKNTGSNVMSADSSLSLQTYLTRITRVRLRLQQVANASDPLEMMQTLAQTVFQGKS
VDLTDTQQYGSLISASLGEEWSGFGNTLFVQPLTQAWETVLLPSATSLNDKWRRSVVANWHTAFDGRFPF
AASKSDASLPMLAEFVRKDSGRIERFLTTELNGVLHKEGSHWVPDKVNSHGLVFNPAFLRAINQLSQLSD
ILFTDGSQGISFELQARPAPEIVETQLTIDGQKLRYFNQMADWQTFRWPGETYKPGTLLTWTTVNAGTRL
FGDYSGTWGFIRWLEQGKRHPLDRSQWMMSFSAPDGRTLQWVLRSQLGSGPLALLALRGLTLPDQIFTVD
AAESALVLTTGVGNSDMDEMEL
 
Nucleotide Sequence: 3429 bp     [Download]
>gi|550443072|ref|NC_022566.1|:1472518-1475946 Klebsiella pneumoniae CG43, complete genome
ATGGACAACGTCAATAAACCTGTAGCTATCTCTGTGGCGGCTACGGTTATCGTCTGTATTGCTGCGGTCA
CGCTTCTGGTGCTCCTGGGCGGGCTGGCATGGTGGCTATGGGCGATGGATCGTGCCACGCAGTGGGAAAC
GCTGCGCCCGCTTATCGCCACGGGCTTTATTATCTGGGGGATGGCACTCAGCCTGCTGGTACTGGGGTTT
ATGGCCTTTCGACTGCTGATAAAAGATAAGGTTAAGCCTTCAGCAGCGCCTGTGCGGCAACCCACCAGGC
CCGCCGGGCGCGAAGCCCTTTATGCCCCGCTGAAAAAGTACCTTCACGCACGTTACCGCCTGCGCTGGCG
GCGCAAAGTCCGCCTGCTTTTAGTCACCGGGGACGATGCAGCAATCGAACAACTGGTGCCTGGCCTGCGT
CAGCAGCACTGGCTTGAAGGCAACCGCACCGTGCTGATTTACGGCGGCAGCCTTGCATCGGAGCCTGACC
GAGAAAAATACATCGCGCTGCGCAAGCTGCGCCGTGGCCGTCCTCTGGACGGGATTGTGCGGGTGATGCC
GTCGTCTCTCACCCTGACGCCGCTGATAAGCGAGAGCGACCTGCACGGGCTGGAAAAAATCAGCGAACTG
CTGGGCTATGCCGCCCCGGTCTGGTTATGGAAACTGTGCGACAGTGAGTGGCCGCAGGCTGACCGCGCGG
TGCAGGCGGTAGGGGTTAGCTTCCCGTTGCGCGCCACTGAGGACGATGTCGCCCGTCAGCTTGCGCAAAT
GCTGCCCACGCTGCGGGAGCAGGGGATGCGCCAGATCGCGGAGGAGACCCGCCACGACTTCCTGCTGCGT
CTGGGGCAGCAGCTTATCGACGGGGAGATCGCACAATGGCGCCGGCAGCTGGCGCCGTGGCTGACCGCCT
CGCGGCAGCGGCTTGCGCTGCGAGGCCTGATGTTTAGCCTGCCAGAACCTCGCGCCGTGGATCCGTATCA
GGAAGCTGATACCTCGCCTGCGAGCCAGCCTCATCTCCTGACGCTGCCCGCGACCTGGCAGGGGATCGTC
GATGACTGCCGCCGTTTACGCGGGCATCACGTGGGAATGGCGTGGGAGCGGGGCCTGGCGTGCGGTCTGC
TGGCGATCCTCGGCCTGTGGGCGGCGGGATTGCTGCTCTCCTTTGCCCTCAATTACAGTCAGATTGCTTC
GGTAGCGGGAAAAGCCCGCGACCTGGTGGCCCACCCCTCCGTTTCTGACTATCAACTGACGGCCCTCCAT
GCCCTGCGCAATGAGGCCGGCCGTCTCGTGCACGATGGGCAGAAGGGGGCGCCCTGGTATCGGCGCTTTG
GTCTGGACCATCATCAGCAACTATTAAACGCCGTCCTACCCTGGTACGGTGTGGCAAATCATCGCCTGAT
ACGTGACCCGGCCAATGCCGCGTTGCAGCAGGCGCTCAACGCGCTGGTCAACTCCGCCCCCAATAGCGAC
CAACGAGCCAGGCTGGCGAAACCGGGCTATGACCAGCTGAAAGCCTGGCTGATGATGGCTCGTCCGGATA
AAGCCGATGGCGCATTTTTCGCGCAGACCATGAAAACGGTCCAGCCGACGCGAATGGGGATCTCGACCGG
TCTGTGGCAAAGTCTGGCGCCGGATTTGTGGGCCTTTTATCTCTCCCTGCTGCCCGAGCGGCCAGAGTGG
AAGATCATCCCGGATGCGCAACGGGTGAGTCAGAGCCGTCAGGTTCTGTTGCAGCAGCTAGGTCGCCGCA
ATGCCGAAAGCACCTTATATGAGAACATGCTCAAATCCGTGCGTCGTAATTTTGCCGATGTGTCGCTGGA
AGACATGACCAGTGGCACCGACGCGCGCCGCCTGTTTACCACCGATGAAGTGGTCCCGGGGATGTTTACC
CGCCAGGCATGGGAAGGCGGCATTCAGCAGGCCATTGATAAGGTAGCCAGCTCGCGCCGGGAGGAAATCG
ACTGGGTGCTGAGCGATTCGCGCAAAACGGTGTCGACAGACCTGTCGCCGGAGGCGCTGAAAGCGCGTCT
GACCCGACGCTACTTCACCGATTTCGCCGGCAGCTGGCTGAATTTTCTCAACAGTCTGCGACTTAATCCG
GCGACCAATATCGCCGATGTTACCGACCAGCTCACGCTGATTAGCGATGTCCGCCAGTCGCCGCTGATTG
CCCTGATGAATACCCTTGCCTGGCAGGGGCAGGCGGGGCAACAAAGGGAGGGGCTGTCGGACAGCCTTAT
TAAATCGGCCAAAGATCTGGTGGGCGGGAAAGACAAGCCGGTCATCGACCAGTCGGCAGCCGGCCCGCAG
GGGCCTCTGGATGACACGTTCGGCCCACTGCTCCAGCTGATGGGGAAAAACACGGGCAGCAACGTCATGT
CGGCCGATAGCTCCCTGAGCCTGCAAACCTATCTGACCCGTATCACCCGCGTGCGCCTGCGCCTGCAGCA
GGTTGCGAATGCCTCCGATCCGCTGGAGATGATGCAGACTCTGGCGCAGACCGTCTTCCAGGGGAAAAGC
GTCGACCTGACCGACACGCAACAGTACGGTAGCCTGATTTCGGCAAGCCTTGGCGAAGAGTGGAGTGGCT
TCGGCAACACTCTGTTTGTGCAGCCGCTGACTCAGGCCTGGGAAACCGTGCTTCTGCCGTCGGCGACCAG
TCTGAATGATAAATGGCGCCGTTCGGTGGTCGCCAACTGGCACACCGCCTTTGACGGACGCTTTCCGTTT
GCCGCCAGCAAAAGCGACGCCTCCCTGCCGATGCTGGCTGAGTTTGTGCGCAAAGACAGCGGGCGAATCG
AACGTTTTCTCACGACGGAGCTGAACGGTGTCCTGCATAAAGAAGGTAGTCACTGGGTGCCGGATAAGGT
CAACAGTCACGGCCTGGTCTTTAATCCGGCCTTTCTGCGCGCGATCAACCAGCTAAGCCAGCTGTCCGAC
ATTCTTTTCACCGACGGCAGCCAGGGGATCAGCTTTGAGTTACAGGCCAGGCCTGCCCCGGAGATTGTCG
AGACACAGCTGACGATAGACGGCCAAAAGCTGCGCTATTTCAATCAGATGGCCGACTGGCAGACTTTCCG
CTGGCCGGGGGAGACGTATAAACCCGGCACTCTGCTGACCTGGACCACCGTCAATGCGGGCACGCGTCTG
TTCGGTGACTACAGCGGTACCTGGGGTTTTATTCGCTGGCTGGAGCAGGGTAAACGCCATCCGCTGGATC
GCAGCCAGTGGATGATGAGCTTCTCCGCTCCGGATGGCCGCACCCTGCAGTGGGTATTGCGCTCCCAGCT
TGGGAGTGGCCCGCTGGCGCTTCTGGCGCTGCGCGGATTGACCCTGCCGGATCAGATTTTCACTGTCGAT
GCGGCTGAGAGCGCACTGGTCCTGACGACGGGGGTAGGGAATAGTGACATGGATGAGATGGAATTATGA
 Primer design