SecReT6
Protein ID: 550445178
SecReT6 ID859
T6SS typeN/A
Gene symbol-
Locus tagD364_11515
StrainKlebsiella pneumoniae CG43
Repliconchromosome [GenBank: NC_022566] [Browse all T6SS(s) in this replicon]
Location [Strand]2387364..2390774 [-]
Producttype VI secretion protein VasK
NoteTssM
UniProt IDU5MCY0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.70E-76, Aligned region: 416..734
DUF1215 [PF06744], Evalue: 1.80E-34, Aligned region: 633..652
DUF1215 [PF06744], Evalue: 1.80E-34, Aligned region: 855..973
Protein Sequence: 1136 a.a.     [Download]
>gi|550445178|ref|YP_008660828.1| type VI secretion protein VasK [Klebsiella pneumoniae CG43]
MNIPGNGLGRFGLAGLTLAGMAAIWWGITRYGGMLNINTRGEQVLAFVQVCLALVFVFYLPAMSRRVKES
LYRRQSQQDSVLPGEEGRVALTPPHHITVGEIRQTLRYQYGRAWSRKVRILLIIGSVRDVEQLTPKLTQE
LWQEDQSTLLLWGGDPGAAVDNAWFTALRKLRYRPADGMVWVTSGFDGVLTTMNRTKPRLTPDEMDSVSH
SLKLRFEALGWKLPLYVWSLYEGGNEKNGRITQPVGCLLPAGCTPQIVAEQFTALASLLIEQGIQQICGQ
PQHNFLLALADQLTRKPETVTEPLSVLLNPYRPQPLAGVVFSEASVEAGRSVRHHWGRDNRWETIPDSVL
WLPAGLRPRKQGVNWMRGMSVAAAALMLLWAASMTVSFIANRHLVAIAQEQVRLASAEKQPLAVRLHALS
ALQKTLSQLEYRSQHGAPWYLRAGLSQNDDLLAALFPRYGERAQPLLRDAAAHHLEEQLTAFVQLPPDSP
LREKMTKTAYGQLKQYLMLTRPEKMDATWFATTLMQDWPQHSGIADAVWQGSGPSLLAFYAASLASHPQW
RLPVDDGLVSQVRTRLIRQLGQRNSESTLYQKMLAQVANQYADMRLADMTADTDASRLFSTDEVVPGMFT
RQAWEQAVQPAIEKVVAERRDEMDWVLSDTKQPAAQSTSPETLRARLAERYFADFSGAWLDFLNSLRWQR
AATLSDAIDQLTLMADVRQSPLVALMNTLSVQGRTGQTGEAIADSLVKSARQLFNRDNPPAIDQQSGARG
PLDATFGPVLALLDNRDGGTPTSRLSLQTFLTRVTQVRLRLQQVTNATDPQAMTRLLAQTVFQGKAVDLT
ETRDYGSLVAAGLGQQWSGFGQTLFVRPMEQAWQQVLTPAAESLNAQWRSAVVEDWNSAFGGRYPFKNTS
SEVSLPLLAKYLNSETGRIARFLQTRLNGVLHKEGSRWMADSINAQGLTFNPAFLQAMNTLSHLSDVAFA
NGEAGLHFALRPGTADGVMQTELVIDSQKLVYMNQMPTWRRFSWPADTEAPGASLSWISTRAGTRQYGDF
PGAWGWIRLLDKAVVSAYPGTSSSWSLSWKAPDGLLLNYTLRTEAGEGPLALLALRNFTLPETIFSVRAS
AERVPLTDDIPGEEGY
 
Nucleotide Sequence: 3411 bp     [Download]
>gi|550443072|ref|NC_022566.1|:c2390774-2387364 Klebsiella pneumoniae CG43, complete genome
ATGAATATACCGGGTAATGGCCTGGGCCGGTTTGGCCTGGCCGGGCTTACGTTGGCCGGGATGGCTGCAA
TATGGTGGGGGATCACCCGCTATGGCGGCATGCTGAATATCAATACGCGGGGCGAGCAGGTACTGGCGTT
TGTCCAGGTCTGTCTGGCGTTGGTATTTGTTTTTTACCTTCCTGCAATGTCCCGCCGTGTGAAGGAGAGT
TTATATCGCCGGCAGTCGCAGCAGGACAGCGTCTTACCCGGCGAAGAAGGGCGCGTGGCGCTGACACCTC
CCCATCATATTACGGTGGGGGAAATTCGCCAGACTCTACGCTATCAGTATGGACGCGCCTGGTCCCGCAA
AGTCCGTATTCTGCTGATAATTGGCTCAGTCAGAGACGTAGAACAACTGACCCCAAAGCTCACGCAGGAA
CTCTGGCAGGAAGATCAGAGTACATTATTGCTGTGGGGTGGAGACCCTGGGGCAGCGGTAGATAACGCCT
GGTTCACAGCGCTGCGTAAACTGCGTTATCGCCCGGCTGATGGTATGGTGTGGGTAACATCGGGCTTTGA
CGGCGTTTTGACAACGATGAACAGAACGAAGCCCAGGCTCACGCCAGATGAAATGGACAGTGTGTCTCAC
TCTCTAAAGCTACGCTTCGAAGCTCTTGGCTGGAAACTACCCCTATACGTCTGGTCGCTGTATGAGGGGG
GCAACGAAAAAAATGGACGTATCACTCAGCCTGTAGGCTGCCTGTTACCTGCAGGTTGTACGCCGCAAAT
AGTTGCCGAACAGTTCACTGCCCTGGCGTCGTTACTGATAGAGCAGGGCATCCAGCAGATATGCGGGCAA
CCACAGCACAATTTTTTACTCGCGCTGGCCGATCAGTTGACCCGTAAACCGGAAACGGTGACGGAGCCGT
TATCGGTATTGCTTAATCCTTACCGCCCGCAGCCGCTGGCCGGGGTGGTATTTAGTGAGGCGTCAGTAGA
GGCTGGTCGCAGTGTCCGTCATCACTGGGGACGGGATAACCGCTGGGAAACGATACCAGACTCAGTGCTG
TGGTTGCCAGCCGGTCTACGTCCGCGCAAACAGGGAGTCAACTGGATGCGTGGGATGAGCGTGGCCGCCG
CCGCCCTGATGTTACTCTGGGCCGCCTCAATGACAGTCTCTTTTATCGCCAACCGCCACCTGGTGGCGAT
CGCACAGGAGCAGGTGCGGCTGGCCTCAGCGGAGAAACAGCCGCTGGCCGTACGCCTGCATGCGCTCTCC
GCGTTACAGAAAACGCTTTCTCAACTGGAATACCGCTCGCAGCACGGCGCGCCGTGGTACCTCCGCGCTG
GCCTCAGTCAGAACGATGACCTGCTGGCGGCGCTGTTCCCGCGCTACGGAGAGAGGGCGCAGCCGCTGCT
GCGCGATGCGGCGGCGCATCATCTGGAAGAGCAGCTCACCGCCTTCGTGCAGCTGCCGCCGGACAGCCCA
CTGCGTGAGAAGATGACGAAGACCGCTTACGGACAACTGAAACAATATCTGATGTTGACCCGCCCGGAAA
AAATGGACGCTACGTGGTTCGCCACCACGCTGATGCAGGACTGGCCGCAGCACTCAGGCATCGCTGACGC
CGTCTGGCAGGGCAGCGGCCCTTCGCTGCTGGCATTTTATGCCGCCAGCCTGGCATCGCATCCGCAGTGG
CGTCTGCCTGTCGATGACGGTCTGGTCAGCCAGGTGCGCACACGGTTAATTCGCCAACTGGGCCAGCGCA
ACAGTGAGTCCACGCTTTACCAGAAGATGCTCGCGCAGGTGGCGAATCAGTATGCCGATATGCGCCTGGC
GGATATGACTGCCGACACCGATGCTTCGCGTCTGTTCAGCACTGATGAGGTGGTGCCGGGAATGTTTACC
CGTCAGGCCTGGGAGCAGGCCGTACAGCCGGCCATTGAGAAAGTGGTCGCGGAACGCCGCGATGAAATGG
ACTGGGTGCTGAGCGACACGAAGCAGCCTGCCGCGCAGTCGACGTCGCCGGAAACTCTGCGAGCCCGGCT
GGCGGAGCGTTATTTCGCTGATTTTAGCGGCGCCTGGCTGGATTTTCTCAACAGTTTGCGCTGGCAGCGC
GCGGCGACCCTCTCTGATGCCATTGACCAGCTGACCCTGATGGCCGATGTGCGCCAGTCGCCGCTGGTGG
CGCTGATGAACACCCTGAGCGTGCAGGGGCGAACCGGCCAGACCGGGGAAGCCATCGCCGATTCGCTGGT
CAAATCGGCCAGGCAGCTGTTCAACCGTGACAACCCACCCGCCATCGATCAGCAGTCCGGCGCGCGCGGT
CCTCTGGATGCCACCTTCGGGCCCGTACTGGCGCTGCTGGACAATCGCGACGGCGGGACGCCCACCAGCC
GTCTTAGCCTGCAGACCTTCCTGACCCGCGTCACCCAGGTGCGTCTGCGCCTGCAGCAGGTCACCAACGC
CACCGACCCGCAGGCGATGACGCGACTGCTTGCGCAGACGGTATTCCAGGGCAAGGCTGTGGATCTAACC
GAAACGCGCGACTACGGCAGCCTGGTGGCGGCGGGACTGGGCCAGCAGTGGAGTGGATTTGGGCAGACGC
TGTTTGTTCGCCCGATGGAGCAGGCCTGGCAGCAGGTGCTGACCCCGGCGGCGGAAAGTCTCAACGCCCA
GTGGCGCAGCGCGGTGGTGGAGGACTGGAATAGCGCTTTTGGCGGTCGCTACCCCTTTAAAAATACCAGC
AGTGAAGTCTCTCTGCCGCTGCTGGCAAAATATCTTAATAGCGAGACCGGGCGCATCGCCCGCTTTCTGC
AGACCCGGCTGAACGGTGTGCTGCATAAAGAGGGGAGCCGCTGGATGGCGGACAGTATCAATGCTCAGGG
GCTGACATTTAACCCGGCCTTTCTGCAGGCGATGAATACCCTGAGCCATCTCTCCGACGTCGCGTTCGCC
AACGGCGAAGCGGGATTGCATTTTGCGCTTCGCCCCGGCACCGCGGACGGCGTGATGCAGACGGAGCTGG
TCATCGACAGTCAGAAACTTGTCTATATGAACCAGATGCCGACCTGGCGGCGATTCAGCTGGCCCGCCGA
CACCGAAGCGCCGGGCGCCAGTCTGAGCTGGATCAGTACCCGGGCGGGCACCCGCCAGTATGGCGATTTC
CCGGGCGCCTGGGGGTGGATCCGTCTGCTGGATAAGGCGGTGGTCAGCGCTTATCCCGGAACGAGCAGCA
GCTGGAGCCTGAGCTGGAAAGCGCCGGATGGTCTGTTGCTGAACTACACGCTGCGTACCGAGGCGGGGGA
AGGACCGCTGGCGCTGCTGGCGCTGCGAAACTTTACGCTACCGGAGACGATATTCAGCGTGCGCGCGTCT
GCTGAACGTGTTCCGCTGACCGACGATATACCCGGCGAAGAGGGATACTGA
 Primer design