SecReT6
Protein ID: 551595776
SecReT6 ID861
T6SS typei1
Gene symbol-
Locus tagDESAM_21896
StrainDesulfovibrio hydrothermalis str. sp nov AM13
Repliconchromosome [GenBank: NC_022579] [Browse all T6SS(s) in this replicon]
Location [Strand]2290697..2294209 [+]
Productconserved membrane protein of unknown function
NoteTssM
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.30E-50, Aligned region: 183..435
DUF1215 [PF06744], Evalue: 3.40E-05, Aligned region: 965..1015
Protein Sequence: 1170 a.a.     [Download]
>gi|551595776|ref|YP_008685069.1| conserved membrane protein of unknown function [Desulfovibrio hydrothermalis]
MKKLILQILKALFYVLLFVAAAVASYALVTYKGWPWWAGACLFGGVIGFVVAILFMRKWFLRRRERKFVK
RIVDQDDSAIAAAPVHERARLQDLQTRWMDAVELLRSSELRKRGNPLYVLPWYMVFGESDSGKTTAVASS
RLTTILTDVGPVPGVSATKNCDWWFFEEAIILDTAGRYAIPLDESRDKEEWERFLTLLVKYRKKEPLNGL
IVTVPADRLLGGDEDGLAEYGRSLRRRINELMRVLGVRFPVYVLITKMDLVFGLKGLTEVLPEYTHSQAM
GLVNETMMADPEEFVDKAILSVTERLRELRLLLLDSSSRFDPAFLLFSEELDRLRPRIKAFAVGAFEDNP
YQELPLFRGMFFSSGEQTGEQSSEFISGLSSLKNVEKKLPKTARGLFLHDFFSKILPRDRNLFTPILEFL
KWKLLTRNMGMGVWLLILFFLSGLFSLSYIANQRAMNDLFVAFPEKPVFSEKVDEKIVQIDGFRKKILDL
HNLNSDWWIPRMGLEVSNEAEFEIKKLYCQDVESLLLKPMDEQLDSAVNKLDVKSTEQLTSSFIKLLVWR
IDLIKNRLSTGTRKPLSDFELPSGRAMSTAIEGFNPDLMKYFGELYGSYLEWNDNTEGLSEQKMLLQARL
GKVFSLKGSDFKWLVDWINDNPELEPVTLQDFWGGPQLLLKNEIYVAPAYTQSGHKMLQGFLAELKDAMQ
DVGEFDKKEKAFWVWYAGEYYKIWFNFAEHFADGKKQLLTKNDYRDMAAKMALPNNPYFRLLTQMKDEFS
PIKKIITPPDWVNQVLYFNVVLAQYKASKAKGVEESSEKAQDSLRKIVAEFGGKIAQDVEQRIEVAKRLD
GYINVLDDVSAFTDTQEKAFKSAAALFPGSGGSPGGSSGGGSSGASGSAALKKNPVEGATQAMSALKAHM
NSEGRGSDMFWHLVAGPLDFIVYVIISEASCELQQLWEGQVLAEVAHVPSNKLRENLFGKTGVVNKFITG
TAKPFLSRDTKGWRSKVWMGIPFPFKDDFFTFLNDGARGSQEIQPEYKVTLSTLPTSVNTNATQEPYSTI
LTVECGSAQQVLSNFNYAEEMLFTWKPEDCGTTTLTIKFPGLSLTRSYDGKLGFAKFLGEFRGGVMTFTP
KDFPQQEKALIDLGVETVKVGYAFKGAAPVIELLDIKPLNIPDNISNCWQ
 
Nucleotide Sequence: 3513 bp     [Download]
>gi|551593593|ref|NC_022579.1|:2290697-2294209 Desulfovibrio hydrothermalis str. sp nov AM13 chromosome, complete genome
ATGAAGAAACTAATTCTACAGATACTCAAGGCTCTCTTTTACGTGCTGCTTTTTGTCGCGGCAGCGGTGG
CCTCTTATGCACTGGTTACTTATAAAGGCTGGCCGTGGTGGGCCGGAGCTTGTCTTTTCGGCGGGGTTAT
CGGTTTTGTTGTTGCGATTCTTTTTATGCGTAAATGGTTTTTGCGTAGACGCGAAAGGAAATTTGTCAAG
CGTATTGTCGATCAGGATGATTCTGCCATTGCAGCAGCTCCGGTTCATGAAAGGGCACGTTTGCAGGATC
TGCAAACAAGGTGGATGGATGCTGTGGAACTTTTGCGTTCTTCAGAACTGCGTAAGCGTGGTAATCCGCT
TTATGTTTTGCCTTGGTATATGGTTTTTGGCGAGTCTGATTCTGGTAAAACCACAGCGGTGGCCAGCAGC
AGGCTGACTACTATTCTTACCGATGTAGGGCCTGTGCCGGGTGTTTCTGCTACCAAGAATTGCGACTGGT
GGTTTTTTGAAGAGGCTATAATTTTAGATACCGCAGGTCGCTATGCCATTCCGCTTGATGAGTCACGTGA
CAAAGAGGAATGGGAGAGATTTCTTACGCTTTTGGTTAAGTATCGTAAAAAAGAACCGCTTAACGGTTTG
ATTGTTACGGTCCCCGCTGACAGGCTGTTAGGCGGCGATGAAGACGGACTTGCCGAGTATGGACGCAGTC
TCAGACGGCGTATCAATGAGCTTATGCGTGTACTTGGGGTGCGTTTTCCGGTTTACGTGCTGATTACCAA
GATGGATCTTGTTTTCGGACTTAAAGGACTGACCGAAGTTCTGCCGGAATATACACACTCTCAGGCTATG
GGGCTGGTTAATGAAACTATGATGGCTGACCCTGAAGAGTTCGTGGATAAAGCCATACTCAGCGTAACAG
AGAGATTGCGTGAACTCAGGTTGCTTCTGCTTGACAGCAGCAGTCGTTTTGATCCCGCTTTTCTGCTTTT
TTCAGAGGAACTTGACCGTTTGCGTCCACGGATCAAGGCGTTTGCCGTCGGAGCCTTTGAAGACAATCCA
TATCAGGAACTGCCATTGTTTCGGGGGATGTTCTTTTCCAGTGGTGAACAGACCGGCGAACAGAGTTCAG
AATTTATCAGCGGACTTTCTTCACTTAAAAATGTTGAAAAAAAGTTGCCTAAAACTGCACGCGGTCTCTT
CCTGCATGACTTTTTTTCTAAAATACTGCCTCGCGACCGTAATTTATTCACGCCTATTCTTGAGTTTCTT
AAATGGAAGCTTTTGACCAGAAATATGGGAATGGGTGTCTGGCTGCTGATTCTGTTTTTTTTGAGCGGTC
TTTTCAGTCTGTCATATATCGCCAACCAGAGGGCTATGAATGATCTCTTTGTTGCTTTTCCGGAAAAACC
TGTTTTTTCGGAAAAGGTCGACGAGAAGATTGTTCAAATTGATGGATTCAGGAAGAAAATCCTTGATTTG
CACAATCTTAATTCTGACTGGTGGATTCCACGTATGGGCCTTGAGGTCAGTAATGAAGCTGAATTTGAAA
TAAAAAAATTGTACTGTCAGGACGTAGAATCTCTTCTTCTTAAGCCCATGGACGAACAGCTCGATTCAGC
TGTCAATAAACTGGATGTTAAATCTACGGAACAGCTTACCAGTTCTTTTATAAAACTTTTGGTCTGGCGG
ATTGATTTAATAAAAAATCGTTTAAGCACTGGAACAAGAAAGCCATTATCCGACTTTGAGCTTCCCTCGG
GCAGGGCTATGTCAACTGCGATAGAGGGATTCAACCCCGATTTGATGAAATATTTTGGTGAATTGTATGG
TTCATATCTTGAGTGGAATGATAATACCGAAGGTCTCTCTGAGCAGAAGATGTTATTACAGGCCCGGCTG
GGAAAAGTTTTCAGTCTCAAAGGTTCTGATTTCAAGTGGCTGGTGGATTGGATAAATGACAATCCCGAGC
TGGAGCCGGTTACTTTGCAGGATTTTTGGGGCGGTCCGCAATTGCTTTTGAAAAATGAAATATATGTCGC
TCCAGCGTATACTCAGTCCGGTCATAAAATGTTGCAGGGCTTTCTTGCTGAGCTTAAAGACGCGATGCAG
GATGTAGGTGAATTTGATAAAAAAGAAAAGGCCTTCTGGGTCTGGTATGCAGGTGAATATTATAAAATCT
GGTTTAACTTTGCAGAGCACTTTGCTGATGGCAAAAAACAGCTTCTGACCAAGAATGATTACCGTGACAT
GGCTGCTAAAATGGCATTGCCGAATAATCCTTATTTCCGTTTACTTACTCAGATGAAAGATGAATTCAGT
CCTATTAAAAAAATTATAACCCCTCCGGACTGGGTTAATCAGGTTTTATATTTTAATGTAGTTCTAGCGC
AATACAAGGCCAGCAAGGCCAAAGGTGTTGAAGAGTCCTCTGAGAAAGCTCAGGATTCACTTAGAAAAAT
AGTGGCCGAATTCGGTGGAAAAATAGCTCAGGATGTTGAACAGCGTATAGAAGTTGCTAAGAGGCTTGAT
GGTTATATTAACGTTCTTGATGATGTTTCCGCCTTTACTGATACGCAAGAAAAAGCCTTTAAGAGTGCCG
CGGCCCTTTTTCCCGGTTCAGGGGGAAGTCCGGGCGGTTCTTCCGGCGGAGGTTCAAGCGGGGCATCGGG
TAGTGCTGCGTTGAAAAAAAATCCTGTCGAAGGAGCAACTCAGGCAATGTCTGCGCTTAAAGCTCACATG
AACAGCGAAGGTCGCGGTTCCGATATGTTCTGGCATCTGGTTGCCGGTCCGCTTGATTTTATAGTCTATG
TAATCATATCCGAAGCTTCCTGTGAATTGCAGCAGTTGTGGGAAGGGCAGGTGCTTGCTGAGGTTGCGCA
TGTTCCAAGTAATAAGCTTAGGGAAAATCTTTTTGGCAAAACCGGAGTGGTAAATAAGTTTATTACTGGT
ACGGCCAAGCCTTTTCTGTCTCGCGATACCAAAGGATGGCGCAGTAAGGTCTGGATGGGCATCCCGTTTC
CGTTTAAGGATGACTTCTTTACTTTCTTAAATGACGGCGCACGCGGCAGTCAGGAGATTCAGCCCGAATA
CAAGGTCACCCTTTCCACCCTTCCGACTTCGGTAAATACCAATGCGACGCAGGAACCATATTCAACAATA
CTTACCGTGGAGTGCGGCAGTGCACAGCAGGTTTTGTCTAATTTCAACTATGCAGAGGAAATGCTTTTTA
CCTGGAAGCCGGAAGACTGCGGAACAACTACGCTGACAATCAAGTTTCCCGGACTCAGTCTTACCCGCAG
TTATGATGGAAAGCTTGGTTTTGCAAAGTTTCTTGGTGAATTCCGTGGCGGGGTAATGACATTTACTCCT
AAGGATTTTCCGCAGCAGGAGAAGGCTTTAATCGACCTTGGCGTAGAGACCGTGAAGGTTGGCTATGCTT
TCAAGGGAGCGGCTCCGGTCATCGAATTACTTGATATTAAACCCCTAAATATTCCTGACAACATTTCGAA
CTGCTGGCAATAA
 Primer design