SecReT6
Protein ID: 556554751
SecReT6 ID862
T6SS typei2
Gene symbol-
Locus tagP423_15500
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3163312..3165114 [+]
Productmembrane protein
NoteTssM
UniProt IDU5SQT4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.10E-46, Aligned region: 11..201
IcmF-related [PF06761], Evalue: 2.10E-46, Aligned region: 261..310
DUF1215 [PF06744], Evalue: 6.20E-36, Aligned region: 323..442
Protein Sequence: 600 a.a.     [Download]
>gi|556554751|ref|YP_008723092.1| membrane protein [Escherichia coli JJ1886]
MLLTDLLHGNTQLLTFWMANLPEHPQWKTSPPPELTGAVRKILLRQIGVRNAENTLYQNVLQQVSRNYAD
MTLADMTGDTLTESLFSTEQTVPGMFTRQAWEGQVREAIEQVVTARREEIDWVLSDRQQDTSADISPDTL
RNRLTSRYFTDFAGSWLAFLNSIRWKKEDSLSGILDQLTLMADARQSPLIALTDTIAWQVATGRENRGLS
DSLAKSAQELFNGKEKTPQQSREGDVPAGPLDKTFAPLLRLLGDKSGGGGGDTQLNLQTYLTRVTRVRLK
LQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTRDYGRLIAASLGEEWSGFGQALFVRPVEQSWRQVLTPA
ADSLNRQWQRAIVSHWNQDFAGRYPFKASQNDASLPLLAQYLRDDGRINQFIAANLSGVLKREGRYWVAD
AMNTQGLTVNPDFIRALNRLRDVADTAFASGDAGIHFELRAKPARDVMKTHLVIDGQELEYFNQKERWQR
FNWPDEQWQPGASLSWTSTQAMERILADYRGSWSLIRLLERAQVTPVDSSTFKVVWKAQDGLPLNYLLRV
EQGKGPLALLELKNFRLPGQVFLTGRSMKDAEEYGEDADE
 
Nucleotide Sequence: 1803 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3163312-3165114 Escherichia coli JJ1886, complete genome
ATGTTACTCACCGATCTCCTTCACGGTAATACGCAACTGCTGACCTTCTGGATGGCGAACCTGCCGGAAC
ACCCGCAGTGGAAAACCTCACCGCCACCGGAACTGACCGGCGCGGTGCGTAAAATCCTGCTGCGCCAGAT
TGGTGTGCGTAATGCCGAAAACACCCTCTACCAGAACGTGCTGCAACAGGTGTCCCGCAACTACGCCGAT
ATGACGCTGGCGGACATGACCGGGGATACCCTCACTGAATCTCTTTTCAGTACGGAACAGACGGTGCCGG
GGATGTTCACCCGTCAGGCATGGGAAGGACAGGTCAGGGAAGCTATCGAGCAGGTGGTGACGGCGCGGCG
CGAGGAAATCGACTGGGTACTCAGCGACCGCCAGCAGGATACCTCTGCTGATATCTCGCCGGATACGCTG
CGTAACCGCCTCACCTCACGCTACTTTACCGACTTTGCCGGAAGCTGGCTGGCGTTTCTCAACAGCATTC
GCTGGAAAAAGGAAGACTCGCTCTCCGGCATTCTCGACCAGCTGACGCTGATGGCCGATGCCCGTCAGTC
GCCACTGATTGCACTGACAGACACTATTGCGTGGCAGGTGGCAACAGGCAGGGAAAATCGTGGCCTGTCA
GACTCGCTGGCGAAATCGGCACAGGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCAATCCCGTGAAG
GCGACGTGCCTGCCGGGCCGCTGGATAAAACCTTCGCGCCGCTGCTGCGGTTGCTGGGCGATAAGTCAGG
AGGCGGTGGTGGTGATACGCAACTCAACCTGCAAACGTATCTGACCCGCGTCACCCGCGTACGCCTCAAA
CTGCAACAGGTGACCAACGCCCCCGACCCGCAGGAGATGACCCAGCAACTGGCGCAGACGGTTTTACAGG
GCAAAACCGTTGACCTCACCGACACCCGCGACTACGGGCGGTTAATCGCCGCCAGTCTGGGCGAAGAATG
GAGTGGCTTCGGTCAGGCGCTGTTCGTCCGCCCGGTGGAACAGTCGTGGCGGCAGGTGCTGACGCCCGCA
GCGGACAGCCTGAACCGCCAGTGGCAACGGGCGATTGTCAGTCACTGGAATCAGGACTTCGCTGGCCGCT
ATCCGTTCAAAGCCTCACAGAACGATGCCTCTCTTCCCTTGCTGGCGCAGTACCTGCGCGATGACGGACG
CATCAACCAGTTTATCGCCGCCAACCTTTCCGGTGTTCTGAAACGTGAAGGCCGCTACTGGGTGGCTGAC
GCCATGAACACGCAGGGGCTGACGGTCAACCCGGACTTTATCCGCGCCCTGAACCGCCTGCGCGATGTGG
CCGATACCGCCTTTGCCAGCGGCGATGCCGGAATACATTTCGAACTGCGGGCAAAACCGGCGCGTGACGT
GATGAAAACGCATCTGGTGATTGACGGGCAGGAACTGGAGTATTTCAACCAGAAAGAACGCTGGCAGCGT
TTTAACTGGCCGGATGAACAGTGGCAACCCGGCGCATCGCTGAGCTGGACCAGCACACAGGCGATGGAAC
GCATACTGGCGGATTACCGGGGAAGCTGGAGCCTTATTCGCCTGCTGGAACGGGCGCAGGTAACACCGGT
CGACAGCAGCACCTTTAAAGTGGTGTGGAAAGCGCAGGACGGCCTGCCACTGAATTACCTGCTGCGGGTT
GAACAGGGTAAAGGGCCGCTGGCGCTGCTGGAACTGAAAAACTTCCGCCTGCCGGGACAGGTATTTCTGA
CCGGCAGGAGTATGAAGGATGCGGAAGAGTATGGGGAAGACGCCGATGAGTGA
 Primer design