SecReT6
Protein ID: 556573138
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5239
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2133480..2137388 [+]
Productintracellular multiplication and macrophage-killing family protein
NoteTssM
UniProt IDU5V3B7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 42..57
ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 264..541
IcmF-related [PF06761], Evalue: 4.80E-91, Aligned region: 393..495
IcmF-related [PF06761], Evalue: 4.80E-91, Aligned region: 590..913
DUF1215 [PF06744], Evalue: 9.70E-33, Aligned region: 1036..1159
AAA_33 [PF13671], Evalue: 0.0059, Aligned region: 193..307
Protein Sequence: 1302 a.a.     [Download]
>gi|556573138|ref|YP_008741691.1| intracellular multiplication and macrophage-killing family protein [Burkholderia pseudomallei NCTC 13179]
MSYLKRFLRFVFSWQMLACIAVLLVCAAVWFVGPLLAFDELRPLAGVVVRVAVIVLLVALLAFWLLRWPL
SPIGVAALCLLIWHAGPLFAFGDHRPFGPAWVRVLIIAAMLFCYAVYGLYRLWQAVRTNDALLKRILEPS
AGKPDAAAQANIRAVSVAVSKAIGQLKRLRGGAFGWRRLLESGRYLYELPWYMVVGAPGAGKSVAIARSG
LTFPLADQMEASSERARGGTANCEWWFANEAVLIDTAGRYVRHEVPGDEEATVANGAEWKGFLGLLRKHR
PRAPVNGVVLSVSVEELVGRTPAERTAHAATLRARLGELHQELGIHFPVYVIVTKLDLLPGFPEYFQSLT
AEGRTQIWGFTLPYDAENRRSAVGALREHCADELKRLEMRIDAGLNNRLLEEYENDRRKRLYALPQEFRS
LSAALSDMLALVFLDSRYDDAQLQNTLRGVYFTSAEQTDQVLAADRETILQRLKRQLGRMLGGDAGAQTR
DSGAVSGSRGYFLRDVFQHVIVPEAHLVRPNVRWEVRFRLMRWAGHLLAVALLVWLASALTVSFDNNRGY
LDAISEKTAALAARVNAYNKAPKPAQIGGVLDGARDLPQHGNLDLDAPGASFRYGLYVAPGIVDASDATY
RSLLRRSLLPQIVRRVEDALSAQIDAKHADEVYRTLTVYLMLDDAARHDAKAVKDWVMRDWERSDSAAEM
GGRNLMARHLDALFVDARPFEPSGHRNAALVQRARLFLNANPAPRRLYERAMAAIEKEAPENFTLARAVG
LQGAGIFRLADGSRFQRGMPGLYTYDGYHQVFSARLPEFLARAQSDDAWVMGNAGPAARWGDAIRNTQAV
AGRSSLADDIRRQYLTDYGDYWQQYLADIRPASSGEDGAGGTLAFDLATLRALAAPDSPLVRLARAVVRE
TSLSVVDAREDASLTDAALSSLGRRSGAAKEVADGAQKLAARRPEQRLEKELVDNRFAALREVVTGQADT
GSGPAMTDVPVAAGGRALQLDAILTLINEQYTRLVVADNALSSQSMPPALDIGTTLQMEAEKLPAPLRTV
LGGIATQAADKVGREVGSLLAMQVDSSVGNACRAAVDGKYPFARSVQEVDIEDFNRLFAAGGLFDAFFQK
ALAPHVDTHSKPWRYKALNPGMPPIRGPSLEPFERAAAIRDVFFREPGAKRMAWRMDAKVASIDPEITEL
IVDVDGQSQRYVHGPVLPFSVNWPGPRGGAIAEITAKPRIRPDTSTIATTGPWALFRLIERGRLTGTTSA
SRLMLDFDFDGRHAALELRTNGQMNPLTSGLLTHFRCPGSVG
 
Nucleotide Sequence: 3909 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2133480-2137388 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGTCTTACCTGAAACGCTTCTTGAGATTCGTCTTTTCGTGGCAGATGCTCGCGTGCATCGCGGTGCTGC
TTGTTTGCGCCGCCGTATGGTTCGTCGGTCCCCTGCTCGCGTTCGACGAGTTGCGGCCGCTCGCGGGCGT
CGTCGTGCGGGTCGCCGTCATCGTCCTTCTCGTGGCGCTCCTCGCGTTCTGGCTGTTGCGCTGGCCGCTC
AGCCCGATCGGCGTCGCCGCACTGTGTCTGCTGATCTGGCACGCGGGGCCGCTCTTCGCGTTCGGCGATC
ACCGCCCGTTCGGGCCCGCGTGGGTCCGCGTGCTGATCATCGCCGCGATGCTCTTCTGCTACGCCGTGTA
TGGTCTCTATCGCCTGTGGCAGGCGGTTCGGACGAACGACGCATTGCTCAAGCGCATTCTCGAGCCGTCG
GCGGGCAAGCCGGACGCAGCGGCCCAGGCGAACATCCGTGCGGTGAGCGTGGCGGTGTCGAAGGCGATCG
GTCAACTGAAGCGCTTGCGCGGCGGTGCGTTCGGCTGGCGGCGCTTGCTCGAAAGCGGGCGCTACCTGTA
TGAACTGCCGTGGTACATGGTGGTCGGCGCGCCTGGTGCGGGCAAGAGCGTGGCGATCGCGCGTTCCGGC
CTGACGTTTCCGCTCGCGGATCAGATGGAGGCATCGTCCGAGCGCGCGCGGGGCGGCACGGCCAATTGCG
AATGGTGGTTCGCCAACGAGGCCGTGTTGATCGACACGGCGGGCCGTTACGTGCGGCACGAGGTGCCCGG
CGACGAAGAGGCGACAGTTGCCAACGGGGCGGAGTGGAAGGGCTTTCTCGGTCTGCTTCGCAAACATCGG
CCGCGCGCGCCGGTCAATGGCGTGGTCCTGTCGGTCAGCGTCGAGGAGCTCGTCGGGCGCACGCCGGCCG
AGCGCACCGCGCACGCAGCCACGCTGCGCGCCCGCCTGGGCGAGTTGCATCAGGAACTGGGCATTCATTT
CCCGGTATACGTGATCGTCACGAAACTCGATTTGCTGCCCGGCTTTCCGGAGTATTTCCAGTCGTTGACG
GCCGAAGGGCGGACGCAGATCTGGGGATTCACGCTGCCCTACGACGCGGAGAACAGGCGAAGCGCGGTCG
GCGCGCTGCGCGAGCATTGCGCCGACGAGCTGAAGCGGCTGGAGATGCGTATCGACGCGGGGCTGAACAA
CCGTCTGCTCGAAGAGTACGAAAACGATCGCCGCAAGCGGCTGTATGCGTTGCCGCAGGAGTTCCGGAGC
CTGTCGGCCGCGCTGTCGGACATGCTCGCCCTCGTGTTTCTCGATTCACGCTACGACGACGCCCAGTTGC
AGAACACGCTGCGCGGCGTCTACTTCACGAGCGCCGAGCAGACGGATCAGGTATTGGCCGCGGATCGCGA
AACCATCCTGCAGCGCTTGAAGCGCCAGCTCGGCAGAATGCTCGGCGGCGATGCCGGCGCGCAGACGCGT
GACAGCGGCGCGGTGTCGGGCAGCCGCGGCTACTTCCTGCGCGATGTGTTCCAGCATGTGATCGTGCCGG
AGGCGCATCTGGTTCGGCCGAACGTCAGGTGGGAGGTGCGTTTTCGCCTGATGCGCTGGGCCGGGCATCT
GCTCGCCGTCGCATTGCTGGTCTGGCTGGCGAGCGCGCTGACGGTGAGCTTCGACAACAATCGCGGTTAC
CTGGACGCGATCTCGGAAAAGACAGCCGCGCTCGCCGCACGAGTCAACGCGTACAACAAGGCGCCGAAGC
CGGCGCAGATCGGGGGTGTACTGGATGGCGCGCGCGATCTTCCTCAGCATGGCAATCTCGATCTCGACGC
GCCCGGCGCGAGCTTCCGCTACGGCCTGTATGTCGCACCCGGCATCGTCGACGCGTCCGACGCGACTTAT
CGGAGCCTGCTGCGCCGGAGCCTTCTGCCGCAGATCGTGCGGCGCGTCGAAGATGCACTGAGCGCGCAAA
TCGATGCGAAGCATGCGGACGAGGTCTATCGCACGCTGACGGTCTACTTGATGCTCGACGACGCCGCGCG
CCATGACGCGAAGGCGGTGAAAGACTGGGTCATGCGCGACTGGGAGCGCTCGGATAGCGCGGCCGAGATG
GGGGGGCGCAATTTGATGGCGCGGCACCTGGACGCGCTGTTCGTCGATGCTCGGCCTTTCGAGCCGAGCG
GGCACCGGAACGCCGCACTCGTTCAGCGCGCCCGGCTTTTCCTCAACGCGAACCCGGCCCCGAGGCGGCT
GTACGAGCGTGCGATGGCCGCGATCGAGAAGGAGGCGCCGGAGAACTTCACGCTCGCGCGTGCGGTCGGG
CTTCAGGGCGCGGGCATCTTTCGGCTCGCCGACGGCTCGCGGTTTCAACGCGGGATGCCCGGCTTGTATA
CGTACGATGGCTACCACCAGGTATTCAGCGCCCGGTTGCCCGAATTTCTCGCCCGTGCGCAAAGCGACGA
CGCATGGGTGATGGGGAACGCCGGCCCCGCCGCGCGATGGGGCGACGCGATTCGGAACACGCAGGCCGTT
GCGGGTCGGTCTTCGCTTGCCGACGACATTCGTCGCCAGTACCTGACGGATTACGGCGACTATTGGCAAC
AGTATCTGGCGGACATTCGGCCCGCGTCGTCCGGAGAGGACGGCGCGGGCGGCACGCTCGCATTCGATCT
CGCGACGCTGCGCGCGCTCGCCGCCCCCGATTCACCGCTCGTGAGACTGGCGCGCGCCGTCGTTCGCGAA
ACATCGCTGTCGGTCGTCGACGCACGGGAAGACGCGTCGTTGACCGACGCCGCGCTTTCGTCGCTCGGGC
GACGATCCGGCGCGGCGAAGGAGGTTGCCGACGGCGCGCAGAAACTGGCGGCGCGGCGGCCGGAGCAGCG
CCTCGAGAAGGAACTGGTGGACAACCGCTTCGCGGCGCTGCGCGAGGTGGTGACGGGGCAGGCCGACACG
GGAAGCGGGCCGGCGATGACGGACGTGCCGGTCGCGGCGGGGGGCCGGGCGCTGCAGCTCGATGCGATCC
TCACGCTGATCAACGAACAGTACACGCGCCTCGTCGTTGCCGACAACGCGCTCTCCTCGCAGAGCATGCC
GCCCGCGCTGGACATCGGCACCACCTTGCAAATGGAGGCGGAGAAACTGCCCGCGCCGCTGCGCACGGTG
CTGGGCGGCATCGCGACGCAAGCCGCCGACAAAGTCGGGCGCGAAGTGGGTTCGCTGCTCGCGATGCAGG
TGGACTCGAGTGTCGGCAACGCGTGTCGCGCCGCCGTCGACGGCAAGTATCCGTTCGCGCGCAGCGTGCA
GGAAGTCGACATCGAGGATTTCAACCGCCTCTTCGCCGCGGGCGGCCTGTTCGACGCGTTTTTTCAGAAG
GCGCTCGCGCCGCATGTCGACACCCATTCGAAGCCGTGGCGTTACAAGGCGTTGAATCCCGGCATGCCGC
CGATCCGGGGGCCGAGCCTCGAGCCGTTCGAGCGCGCCGCCGCGATTCGCGACGTGTTCTTTCGTGAACC
GGGCGCAAAGCGGATGGCGTGGAGGATGGATGCGAAGGTGGCGTCGATCGACCCTGAGATCACCGAGCTC
ATCGTCGACGTCGACGGCCAGTCGCAGCGCTATGTCCACGGCCCCGTGCTGCCGTTCTCCGTGAACTGGC
CCGGGCCGCGCGGCGGCGCGATCGCCGAGATCACCGCGAAGCCGCGGATTCGTCCCGATACGTCGACGAT
CGCGACGACGGGGCCCTGGGCGCTGTTTCGGCTGATCGAGCGCGGGCGGTTGACGGGCACCACGTCGGCG
AGCCGGTTGATGCTGGATTTCGATTTCGACGGTCGGCACGCGGCCCTGGAGCTCAGGACGAACGGCCAGA
TGAATCCGTTGACGAGCGGCTTGCTGACGCATTTTCGCTGTCCGGGGAGCGTCGGTTGA
 Primer design