SecReT6
Protein ID: 556573159
SecReT6 ID864
T6SS typei3
Gene symbol-
Locus tagBBK_4870
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]1688637..1692266 [-]
Productintracellular multiplication and macrophage-killing family protein
NoteTssM
UniProt IDU5V360
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-96, Aligned region: 213..478
ImcF-related_N [PF14331], Evalue: 1.30E-96, Aligned region: 1062..1079
IcmF-related [PF06761], Evalue: 1.20E-95, Aligned region: 370..390
IcmF-related [PF06761], Evalue: 1.20E-95, Aligned region: 526..836
DUF1215 [PF06744], Evalue: 9.40E-34, Aligned region: 65..87
DUF1215 [PF06744], Evalue: 9.40E-34, Aligned region: 945..1069
Protein Sequence: 1209 a.a.     [Download]
>gi|556573159|ref|YP_008741322.1| intracellular multiplication and macrophage-killing family protein [Burkholderia pseudomallei NCTC 13179]
MSHAVARIVRPLPSRDIWTFAGLVVLACFVWLAGPLFAFAEFRPFESGAVRAATIVALFVAWGARIAWRG
WRAGQLNAQLLNQLREAAPRPAATGDPAQAQLDELRSRFDEAATLLKKVRFGEADGARKGLPRWLEQMSR
QYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAAIRGVGGTRHCDWWFTNDAVLIDTAGRYTTH
ESNRALDEAEWKGFVDLLKKYRARQPLNGAMLTISVADLLGASEAERTQHAMVLRKRLLELRAQLGIRFP
VYLLVTKADLLAGFAEYFGGFGRAECAQVWGFTFPLAESEAPGFELRAAFDREYRLLHQRLNDGLPELLA
SQTDARQREMTYLLPQQIADLQDMLGQFVAEVFSVSSFEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPAAQTGSSGRSFFLKSLLQDHIFREAALAGSNLRWHQRQRALQIVGYAAIALLCVAVLFAWLRS
YSRNRDYLDEVAARVPAVDAQIGRAKFTGAADIVQLLPVLDELSGLPNAGGVDLRHPPLAYRWGLFQGEK
IEEASDAVYRRALDDVLLPIAASRMEQALRDARPDEVEYAYAALKAYLMLYDSAHYDPAFVQAVVDLEME
RALPADFSSAQRSALRAHLGALFGNRVAVSPFPMNERLVADVRERLRQVPFSQRLYRQLARTLHASTASY
DFSVARAVGPDASLVFRRQSGKSLADGVPGLYTRSGYRNVFAPRLPGAIDSYGREEVWVLNLGASEIPNP
ADAAAWARDIRQLYLNDYIKTWDDYLADIRLQRTSTLAQSIQVARTLSSADSPLTRLMVALARDTPLGDA
PGGARNLASRAQDKVDEARNSLAQIFAGQPGGEAGAAAAPPASPEQIVDSHFAGLRAFAPGGGDQAASFD
AVLKAIDALYTYLTATDDALRSGAAPPPSDAPARLRAQAGRLPTPVREVLDDLSNVANGSIASVEQRNVA
QRAGANVGDFCRQAIAGRYPFARGAARDVAPSDFAQLFAAGGLMDDFFQKNLQTLVDTTAHPWRFNNRNA
EADPSAAAMLGSFEKAAVIRDVYFGGGARTAQIKVEIVPLEMDPSISEMLLDVDGQIVRYAHGPQVPTAV
QWPGTRGSNQVRLQVTEQSGATGGFTTEGPWALHRLFDRAGVSGGRGPEQMVARFAVDGKPIVLQVTASS
VRNPFRLPQMESFTCPPKQ
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c1692266-1688637 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAGCCACGCTGTCGCACGCATCGTTCGCCCGCTGCCGTCGCGGGACATCTGGACGTTCGCCGGCCTCG
TCGTGCTGGCGTGTTTCGTTTGGCTTGCCGGGCCGCTGTTCGCGTTCGCCGAGTTCCGCCCGTTCGAGAG
CGGCGCGGTGCGCGCGGCGACGATCGTCGCGCTGTTCGTCGCGTGGGGCGCGCGGATCGCGTGGCGCGGC
TGGCGCGCGGGGCAACTGAACGCGCAGTTGCTCAACCAGTTGCGCGAAGCGGCGCCGCGGCCCGCCGCGA
CGGGCGATCCCGCGCAGGCGCAGCTCGACGAGCTGCGCAGCCGCTTCGACGAAGCCGCGACGTTGTTGAA
GAAAGTCCGTTTCGGCGAAGCCGACGGCGCGCGCAAGGGCCTGCCGCGGTGGCTCGAGCAGATGTCGCGC
CAGTATCTGTACCAACTGCCGTGGTACGTGTTCATCGGCGCGCCGGGCTCGGGCAAGACGACGGCGCTCG
TCAACTCGGGGCTGAGCTTTCCGCTCGCCGAGCAGTTCGGGCGCGCGGCGATTCGCGGCGTCGGCGGCAC
GCGGCACTGCGACTGGTGGTTCACGAACGACGCGGTGCTGATCGACACCGCGGGCCGCTACACGACGCAC
GAGAGCAACCGCGCGCTCGACGAGGCCGAATGGAAGGGCTTCGTCGATCTGCTGAAGAAGTACCGCGCGC
GCCAGCCGCTGAACGGCGCGATGCTGACGATCAGCGTCGCCGATCTGCTCGGCGCGTCGGAGGCGGAGCG
CACGCAGCACGCGATGGTGCTGCGCAAGCGCCTGCTTGAGCTGCGCGCGCAGCTCGGCATCCGCTTTCCG
GTGTATCTGCTCGTGACGAAGGCGGATTTGCTCGCCGGCTTCGCCGAATACTTCGGCGGCTTCGGCCGCG
CCGAATGCGCGCAGGTGTGGGGCTTCACGTTCCCGCTCGCCGAGAGCGAAGCGCCCGGCTTCGAGCTGCG
CGCGGCGTTCGACCGCGAATACCGGCTGCTGCACCAGCGGCTGAACGACGGGCTGCCGGAGCTGCTCGCA
TCGCAGACCGACGCGCGCCAGCGCGAGATGACCTACCTGCTGCCGCAGCAGATCGCCGATCTGCAGGACA
TGCTCGGCCAGTTCGTCGCCGAGGTGTTCTCGGTGTCGAGCTTCGAGCCGATGCCGATGCTGCGCGGCGT
CTATCTGACGAGCGGCACGCAGGAAGGCACCGCGTTCGACCGCGTGATGAGCGGGATCAAGCGCTTCCTG
AAGATCGAGGGCGTGCCGCCCGCCGCGCAGACGGGCTCGTCGGGCCGCAGTTTCTTCCTGAAATCGCTGC
TGCAGGATCACATCTTTCGCGAGGCGGCGCTTGCCGGCAGCAATCTGCGCTGGCATCAGCGGCAGCGTGC
GCTGCAGATCGTCGGCTACGCGGCGATCGCGCTGCTGTGCGTGGCGGTGCTGTTCGCGTGGCTGCGCAGC
TACTCGCGCAATCGCGACTATCTCGACGAGGTCGCCGCGCGCGTGCCGGCGGTCGACGCGCAGATCGGCC
GCGCAAAATTCACGGGCGCGGCCGACATCGTGCAGCTGCTGCCGGTGCTCGACGAGCTGAGCGGCCTGCC
GAACGCGGGCGGCGTGGACTTGCGGCATCCGCCGCTCGCGTATCGCTGGGGCCTGTTCCAGGGCGAGAAG
ATCGAGGAGGCGAGCGACGCCGTCTACCGGCGCGCGCTCGACGACGTGCTGCTGCCGATCGCCGCGAGCC
GGATGGAGCAGGCGCTGCGCGACGCGCGGCCCGACGAGGTCGAGTATGCGTACGCGGCGCTCAAGGCGTA
CCTGATGCTTTACGACAGCGCGCACTACGATCCCGCGTTCGTGCAGGCCGTCGTCGATCTCGAGATGGAG
CGCGCGCTGCCGGCCGATTTCTCGTCCGCGCAGCGCAGCGCGCTGCGCGCGCATCTCGGCGCGCTGTTCG
GCAATCGCGTCGCGGTGTCGCCGTTTCCGATGAACGAGCGGCTCGTCGCCGACGTGCGCGAGCGGCTGCG
GCAGGTGCCGTTCTCGCAGCGGCTGTATCGGCAGCTCGCGCGCACGCTGCACGCGAGCACCGCGTCGTAC
GATTTCAGCGTCGCGCGCGCGGTGGGGCCGGACGCGTCGCTCGTGTTCCGGCGGCAGAGCGGCAAGAGCC
TCGCCGACGGCGTGCCGGGCCTCTACACGCGCAGCGGCTACCGCAACGTGTTCGCGCCGCGTCTGCCCGG
CGCGATCGATTCGTACGGGCGCGAGGAGGTGTGGGTGCTGAACCTCGGCGCGTCCGAGATCCCGAATCCG
GCCGACGCGGCCGCCTGGGCGCGCGACATCCGGCAGCTCTACCTGAACGACTACATCAAGACCTGGGACG
ACTATCTGGCCGACATCCGGCTGCAGCGCACGTCGACGCTCGCGCAGAGCATCCAGGTCGCGCGCACGCT
GTCGTCGGCCGATTCGCCGCTCACGCGGCTGATGGTCGCGCTCGCGCGCGACACGCCGCTCGGCGATGCG
CCCGGCGGCGCGCGCAATCTCGCGTCGCGCGCGCAGGACAAGGTCGACGAGGCGCGCAACTCGCTCGCGC
AGATCTTCGCCGGGCAGCCGGGCGGCGAAGCGGGCGCGGCGGCCGCGCCGCCCGCGAGCCCCGAGCAGAT
CGTCGACAGCCACTTCGCGGGGCTGCGCGCGTTCGCGCCGGGCGGCGGGGATCAGGCGGCGTCGTTCGAC
GCGGTGCTCAAGGCGATCGACGCGCTGTACACGTACCTCACCGCGACCGACGACGCATTGCGCAGCGGCG
CGGCGCCGCCGCCGTCGGACGCGCCCGCGCGGCTGCGCGCGCAGGCGGGCCGGTTGCCGACGCCTGTGCG
CGAGGTGCTCGACGATTTGTCGAACGTCGCGAACGGCAGCATCGCGAGCGTCGAGCAGCGCAACGTCGCG
CAGCGCGCGGGCGCGAACGTCGGCGATTTCTGCCGGCAGGCGATCGCCGGGCGCTACCCGTTCGCGCGCG
GCGCGGCGCGCGACGTCGCGCCGTCCGATTTCGCGCAACTGTTCGCGGCGGGCGGCCTGATGGACGACTT
CTTCCAGAAGAACCTGCAAACGCTCGTCGACACGACCGCGCATCCGTGGCGTTTCAACAACCGCAACGCC
GAAGCCGACCCGTCGGCGGCCGCGATGCTCGGCTCGTTCGAGAAGGCGGCGGTGATCCGCGACGTCTATT
TCGGAGGCGGCGCGCGGACCGCGCAGATCAAGGTCGAGATCGTGCCGCTCGAAATGGACCCGTCGATCTC
GGAGATGCTGCTCGACGTCGACGGCCAGATCGTCCGCTACGCGCACGGCCCGCAGGTGCCGACGGCGGTG
CAGTGGCCCGGCACGCGCGGCAGCAATCAGGTGCGGCTGCAGGTGACCGAGCAGTCGGGGGCGACGGGCG
GCTTCACGACCGAGGGCCCGTGGGCGCTGCACCGGCTGTTCGACCGCGCGGGCGTGTCGGGTGGGCGCGG
GCCCGAGCAGATGGTCGCGAGATTCGCGGTCGACGGCAAGCCGATCGTGCTGCAGGTGACGGCGAGCAGC
GTTCGCAACCCGTTCCGGTTGCCGCAGATGGAGTCCTTTACATGTCCTCCGAAGCAATGA
 Primer design