SecReT6
Protein ID: 557222688
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09900
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2172981..2174510 [+]
Productsigma-54 dependent transcriptional regulator
NoteSfa2
UniProt IDU5VGJ7
KEGG IDpsv:PVLB_09900
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 1.00E-71, Aligned region: 196..362
Sigma54_activ_2 [PF14532], Evalue: 3.80E-24, Aligned region: 197..367
HTH_8 [PF02954], Evalue: 9.10E-13, Aligned region: 353..360
HTH_8 [PF02954], Evalue: 9.10E-13, Aligned region: 457..496
GAF_2 [PF13185], Evalue: 1.20E-06, Aligned region: 26..145
GAF_2 [PF13185], Evalue: 1.20E-06, Aligned region: 264..272
GAF_3 [PF13492], Evalue: 1.80E-06, Aligned region: 28..143
GAF_3 [PF13492], Evalue: 1.80E-06, Aligned region: 203..263
HTH_30 [PF13556], Evalue: 1.50E-05, Aligned region: 466..498
AAA_5 [PF07728], Evalue: 0.00014, Aligned region: 220..337
Protein Sequence: 509 a.a.     [Download]
>gi|557222688|ref|YP_008762903.1| sigma-54 dependent transcriptional regulator [Pseudomonas sp. VLB120]
MFTHVPQPLAYAETLMGTFTELACAADEQGLMQALVQAVAGLSGCALVQVYLLDSTHTRLGLEVACLDGQ
LQARDCASLPADYNGEQLMQFALCQNRMVSIAELSASMFDTSFLPAQATPWQALLAVPLVTPQQRVVGVL
LCVARARIELAGFADSLGRLGAFAMAQLHLLRRLRQPQPQLPASVAKPAEVGSYGLIGDSPAMRQTCQMI
SKVLHSPYTVLVLGETGTGKELVARAIHDYGPRRSGPFVVQNCAAFPEHLLESELFGYRKGAFTGADRDR
PGLFDAADGGTLLLDEIGDMPLALQAKLLRVLQEGEIRPLGANSTHKIDVRIVAATHRDLAQMVRDGQFR
EDLYYRLAQFPIDLPPLRQRDGDVSALARHFSDKACAFLQRSPVIWSNAALNHLEGYGFPGNVRELKGLV
ERAVVLCEGRELAAEHFALNGAASTAGDGELNLRERLEQVERNLLLDCLRKHDGNQTMAARELGLPRRTL
LYRLGRLNIQIGDGAGRLA
 
Nucleotide Sequence: 1530 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2172981-2174510 Pseudomonas sp. VLB120, complete genome
ATGTTCACGCATGTGCCGCAGCCTCTGGCCTATGCCGAGACCTTGATGGGGACCTTCACCGAGCTGGCCT
GCGCCGCTGACGAGCAGGGCCTGATGCAGGCACTGGTCCAGGCGGTGGCCGGGCTCAGTGGCTGCGCGCT
GGTGCAGGTGTACTTGCTCGACTCGACCCACACGCGGCTGGGGCTTGAGGTCGCCTGCCTCGATGGGCAG
TTGCAGGCGCGGGACTGTGCCAGCCTGCCGGCCGACTACAATGGCGAGCAGTTGATGCAGTTCGCCTTGT
GTCAGAACCGCATGGTGAGCATCGCCGAGCTGTCCGCCAGCATGTTCGACACCAGTTTCCTGCCGGCTCA
GGCAACACCATGGCAGGCGCTGCTGGCGGTGCCCCTGGTGACCCCGCAGCAACGGGTGGTTGGCGTGTTG
TTGTGCGTAGCCCGGGCGCGCATCGAGCTGGCCGGCTTTGCCGACTCGCTGGGACGCCTCGGTGCTTTCG
CCATGGCTCAGTTGCATCTGCTGCGGCGTTTGCGTCAACCCCAGCCGCAGCTGCCGGCCAGTGTCGCCAA
GCCGGCCGAGGTCGGTAGTTACGGCCTGATCGGTGACAGCCCGGCCATGCGTCAGACCTGCCAGATGATC
AGCAAGGTGCTGCACAGCCCTTACACCGTGCTGGTGCTCGGTGAGACGGGCACCGGCAAGGAATTGGTGG
CCCGGGCCATCCACGACTACGGCCCTCGCCGTTCGGGGCCATTCGTGGTGCAGAACTGCGCGGCATTTCC
CGAGCACCTGCTGGAAAGCGAGCTGTTCGGTTACCGCAAAGGCGCCTTCACCGGGGCCGACCGCGACCGC
CCGGGACTGTTCGACGCCGCGGACGGCGGCACCCTGTTGCTCGACGAGATTGGTGACATGCCGCTGGCGT
TGCAGGCCAAGTTGCTGCGGGTGCTGCAGGAGGGTGAGATCCGCCCGTTGGGGGCTAACAGCACGCACAA
GATCGACGTGCGCATCGTCGCTGCCACGCACCGTGACCTGGCGCAGATGGTGCGTGACGGTCAGTTCCGT
GAAGACCTCTATTACCGCCTGGCCCAGTTCCCGATCGACTTGCCGCCACTGCGCCAGCGTGACGGCGATG
TGAGTGCCCTGGCACGGCATTTTTCCGATAAGGCCTGTGCGTTCCTGCAGCGCAGCCCAGTGATCTGGTC
CAACGCCGCCCTGAACCACCTCGAAGGCTATGGCTTCCCTGGCAACGTTCGCGAGCTCAAGGGGCTGGTG
GAGCGCGCGGTGGTGCTCTGCGAGGGCCGTGAGCTGGCGGCGGAGCACTTTGCGCTGAACGGCGCCGCAT
CCACAGCGGGCGATGGCGAGCTGAACCTGCGCGAACGCCTCGAGCAGGTCGAGCGCAATCTGCTGCTCGA
CTGCCTGCGCAAGCACGATGGCAACCAGACCATGGCCGCTCGCGAGTTGGGCTTGCCGCGGCGCACCCTG
CTGTACCGACTCGGTCGCCTGAATATCCAGATCGGCGATGGCGCAGGCCGGCTGGCATGA
 Primer design