SecReT6
Protein ID: 557222694
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09930
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2178645..2182172 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDU5VD31
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.10E-80, Aligned region: 240..338
IcmF-related [PF06761], Evalue: 1.10E-80, Aligned region: 495..785
IcmF-related [PF06761], Evalue: 1.10E-80, Aligned region: 845..904
ImcF-related_N [PF14331], Evalue: 2.40E-70, Aligned region: 196..446
DUF1215 [PF06744], Evalue: 3.70E-33, Aligned region: 910..1032
DUF4131 [PF13567], Evalue: 0.007, Aligned region: 14..86
DUF4131 [PF13567], Evalue: 0.007, Aligned region: 440..461
Protein Sequence: 1175 a.a.     [Download]
>gi|557222694|ref|YP_008762909.1| type VI secretion protein IcmF [Pseudomonas sp. VLB120]
MKNVFKKVGAFLARTWVWSLLLVLALALLVWFVGPLLAVADDKFWEDAAARLLTISVLFLLWGLWMVYAS
WRANHRKQKVLESEGGQERLEREERKYEAAKEIRARFKHALATLNTSSLYGGRHDRWRRDLPWYLVLGAN
GSGKTSLLEHSGLEFPINALERRRSQDAGNGEYCNYYFAEQGVLVDTGGRFLEQRDSELDGHAWRTLLDL
LRQRRRNRPLNGVLITVPMDTLLGGDAALNDLAQKVRSRLQELRQRLHQDLPVYLVLTKTDRLAGFEEFF
DQQSREENEQVFGVTFGKGKNGADTELLANEFQGLLQRLGDQVTQRIHHERNTLRRARILDFPHQLGRIG
DQLCLLVDAAFTGNRYQRASHLRGVYLTSAPHLAPQVDSDNGFQPGIPGHGIPRGRARFMLQLFTRVVFP
EYDLAGLDRRERRRINWGQRAVYLTALGALVLFGLLWANSFSGNHERLEALRELARQWQHQHQSLDGRDD
ALAALKPLDSAYQAARVFPDSGDVSLLQRAGLYQGGAANEVLQPAYQRELEQVLLPRVGKMVEEQIRSNL
KNRERLLNSLRAYLMLGDPERRDQDWLQDWAAAGWSQRYSGNTAAQEALNAHFGRLLQQPFALPLNDALV
AQARQVLRAESLASVVYRVLREQARSLPEYRLSQQLGPQASQFVGVDYAIPGFYTSQGYQQYFSVQGANL
VNDILRDNWVLGEGPGISDMDMRRLMVALEQLYFRDYANYWGEAINQVGLIPFSDAGEGADQLSALTAAN
SPLLLLLTEVRENTRFPTLPETSDEGEQAAEAAAGKAAAKKLGKNGTAVAGAVAGKARDALAKRPLPDTA
RMALQRRFEPLHRLLDDNNGPGPDLAPTLQALNDLQQQLAGLARSNQVEEASYQMAKARMSGQRDALSSL
RNGTARLPRPVAGWFNLLSDDIWRMVLNDSYNYLNQRYQSELYSFYGKAIESRYPFNAAGTGDVAISDFR
DFFKAQGVADQFFDSYMKPFVSGEPGNYRLRSLDGQSLPMTKTFLEQMGIIQAVRQSFFAQNPQEPQVQF
KLEPYTLDPSVSRAEFRFGDQVIDYRHGPIVSTTFKWPTEAQDGNSSLTLEQINGRPMSLEKNGGPWALF
RLLDLMQTEYLKGRDTMVVKANVGGMRANYLLTSQRSPNPFDLNVLRGLRLPGEL
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2178645-2182172 Pseudomonas sp. VLB120, complete genome
ATGAAGAATGTTTTCAAGAAAGTCGGCGCATTCCTTGCCCGGACCTGGGTGTGGAGTCTGCTGCTGGTGC
TGGCCCTGGCCTTGCTGGTGTGGTTCGTCGGGCCACTGCTGGCCGTCGCCGACGACAAGTTCTGGGAAGA
CGCCGCGGCGCGGCTGTTGACCATCAGTGTGCTGTTCCTGCTCTGGGGATTGTGGATGGTGTACGCCAGC
TGGCGTGCCAACCATCGCAAGCAGAAGGTGCTGGAGAGCGAGGGCGGGCAAGAGCGTCTGGAGCGTGAAG
AGCGCAAGTACGAAGCGGCCAAGGAAATCAGGGCGCGTTTCAAGCATGCCCTGGCCACGCTCAACACCTC
GAGCCTGTACGGTGGCCGTCACGACCGCTGGCGTCGTGATCTGCCATGGTACCTGGTGCTCGGCGCCAAT
GGCTCGGGCAAGACCAGCCTGCTGGAGCATTCGGGGCTGGAGTTTCCCATCAACGCGCTGGAGCGCAGGC
GCTCGCAGGACGCGGGCAATGGCGAATACTGCAATTACTACTTTGCCGAGCAGGGCGTGCTGGTCGACAC
CGGCGGGCGCTTCCTCGAACAGCGCGACAGTGAGCTGGACGGCCATGCCTGGCGCACCTTGCTCGACCTG
CTGCGTCAGCGTCGACGCAATCGGCCGCTCAACGGTGTGTTGATCACCGTACCAATGGATACCTTGCTTG
GCGGTGACGCGGCATTGAACGACTTGGCGCAGAAGGTTCGCTCGCGCTTGCAGGAGTTGCGCCAGCGCCT
GCACCAGGACCTGCCGGTATACCTGGTGCTGACCAAGACCGACCGGCTGGCTGGCTTTGAGGAATTCTTC
GACCAGCAGTCGCGAGAAGAAAACGAACAGGTGTTTGGCGTCACGTTCGGCAAAGGCAAGAATGGCGCCG
ATACCGAGTTACTGGCCAACGAGTTTCAGGGCCTGCTGCAGCGCCTGGGTGACCAGGTCACCCAGCGCAT
CCACCACGAGCGCAATACCTTGCGTCGTGCGCGCATCCTCGATTTCCCGCACCAGCTCGGACGCATCGGT
GACCAATTGTGCCTGTTGGTGGATGCCGCTTTCACCGGCAACCGCTATCAGCGCGCCAGCCACTTGCGCG
GTGTCTATCTGACCAGCGCGCCGCACCTTGCGCCGCAGGTCGATAGCGACAATGGCTTCCAGCCCGGTAT
ACCTGGGCACGGAATCCCGCGGGGGCGGGCGCGCTTCATGCTGCAGTTGTTCACCCGTGTCGTGTTTCCC
GAATACGACCTGGCTGGCCTCGATCGCCGTGAGCGGCGCCGCATCAATTGGGGCCAGCGTGCCGTATACT
TGACGGCACTCGGCGCGCTGGTGCTGTTCGGCCTGCTGTGGGCAAACAGTTTCTCCGGCAACCATGAGCG
TCTGGAAGCGCTGCGTGAACTGGCTCGGCAATGGCAGCATCAGCACCAGAGCCTCGACGGCCGCGACGAT
GCCCTGGCCGCACTCAAGCCGTTGGATTCGGCCTACCAGGCAGCACGAGTGTTTCCCGACAGTGGCGATG
TCTCGCTGCTGCAGCGCGCCGGCCTGTATCAAGGGGGGGCTGCCAACGAGGTGCTGCAACCTGCTTACCA
GCGCGAACTCGAGCAAGTCCTGCTGCCGCGCGTCGGCAAGATGGTGGAAGAGCAGATTCGCAGCAACCTG
AAGAACCGCGAACGCTTGCTCAACAGCCTGCGTGCCTACCTGATGCTGGGCGATCCCGAGCGTCGAGATC
AGGACTGGTTGCAGGATTGGGCGGCAGCCGGCTGGTCGCAGCGCTACAGCGGCAACACCGCCGCGCAGGA
GGCGCTCAACGCACACTTCGGGCGCCTGTTGCAGCAACCGTTCGCCTTGCCGCTCAATGATGCGCTGGTG
GCACAGGCGCGTCAGGTGTTGCGTGCAGAGTCGCTGGCCAGCGTGGTCTACCGAGTGCTGCGAGAACAGG
CCCGCAGTCTGCCCGAGTACCGCCTGAGCCAGCAGTTGGGGCCACAGGCGAGCCAGTTCGTGGGGGTCGA
CTATGCGATTCCGGGCTTCTACACCTCCCAGGGTTACCAGCAATACTTCTCGGTGCAGGGCGCCAACCTG
GTCAACGACATCCTGCGTGACAACTGGGTGCTGGGGGAGGGGCCAGGTATCAGCGACATGGACATGCGAC
GGCTGATGGTGGCGCTGGAACAGTTGTATTTTCGCGACTACGCCAATTATTGGGGGGAGGCGATCAACCA
GGTCGGCTTGATTCCGTTCAGCGACGCGGGGGAAGGCGCTGACCAATTGTCGGCGCTCACCGCCGCCAAC
TCGCCGTTGTTGCTGCTGCTGACCGAAGTGCGCGAGAACACCCGTTTCCCGACGTTGCCAGAGACGTCAG
ACGAGGGCGAGCAGGCAGCCGAGGCGGCCGCTGGCAAGGCCGCGGCCAAGAAGCTTGGCAAGAACGGCAC
TGCCGTGGCTGGCGCGGTCGCCGGCAAGGCCCGTGACGCCCTGGCCAAGCGACCGCTGCCAGACACCGCG
CGCATGGCGCTGCAACGGCGCTTCGAGCCGCTGCACCGTTTGCTCGATGACAACAACGGCCCAGGGCCTG
ATCTGGCGCCGACCCTGCAAGCGCTGAACGATCTGCAACAACAATTGGCCGGGCTGGCGCGCTCCAACCA
GGTCGAGGAAGCTTCGTACCAGATGGCCAAGGCGCGCATGTCGGGCCAACGTGACGCCTTGAGCAGCCTG
CGCAACGGCACCGCCCGACTGCCACGGCCAGTGGCGGGCTGGTTCAACCTGCTCTCGGACGACATCTGGC
GCATGGTCCTGAACGACAGCTACAACTACCTCAACCAGCGTTACCAGAGTGAGCTGTACAGCTTCTATGG
CAAGGCCATCGAGTCGCGCTACCCGTTCAACGCCGCAGGCACCGGCGATGTGGCGATCAGCGATTTCCGC
GACTTCTTCAAGGCCCAGGGTGTAGCCGACCAGTTCTTCGACAGCTACATGAAGCCGTTCGTCAGTGGCG
AGCCAGGCAACTATCGCTTGCGCAGCCTGGACGGCCAGAGCCTGCCGATGACCAAGACGTTCCTTGAACA
GATGGGCATCATCCAGGCCGTGCGCCAGAGCTTCTTTGCGCAAAACCCGCAAGAGCCGCAAGTGCAGTTC
AAGCTCGAACCGTACACCCTCGATCCATCGGTGAGTCGCGCTGAGTTTCGCTTCGGTGACCAGGTGATCG
ACTACCGTCATGGTCCGATTGTCTCCACCACGTTCAAGTGGCCGACCGAGGCACAGGACGGCAACAGCAG
CCTGACCCTGGAGCAAATCAATGGCCGCCCCATGTCGCTGGAAAAGAACGGCGGCCCGTGGGCGCTGTTC
CGCTTGCTCGACCTGATGCAGACCGAGTACCTCAAGGGCCGCGACACCATGGTGGTCAAAGCCAACGTCG
GAGGTATGCGCGCCAACTACCTGCTGACCAGCCAGCGCTCGCCCAACCCGTTCGACCTGAACGTGTTGCG
TGGCCTGCGGCTGCCGGGTGAACTCTGA
 Primer design