SecReT6
Protein ID: 557222695
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09935
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2182172..2182900 [+]
Productserine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDU5VCN8
KEGG IDpsv:PVLB_09935
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 7.80E-16, Aligned region: 19..204
PP2C [PF00481], Evalue: 2.10E-12, Aligned region: 31..204
SpoIIE [PF07228], Evalue: 8.70E-10, Aligned region: 36..240
Protein Sequence: 242 a.a.     [Download]
>gi|557222695|ref|YP_008762910.1| serine/threonine phosphoprotein phosphatase Stp1 [Pseudomonas sp. VLB120]
MLHANPWRSAARTDAGKVRARNEDAFLDCPQHGLWAVADGMGGHEDGDVASQMIVASLAELAPAASFDER
VVAVRQCLHWINRRLGQELTVSVEGHARIIGSTVVTLLLEGRRGACVWAGDSRCYLWRGHRLYQLTRDHS
LAQQLIDQQRMSAEQARGHPSARALTRAVGASAELKLEVLEFEALPGDVFLLCSDGLYDSLQSDGLGHAL
DLASPADALQRLFATALGGAAKDNLTAVVIHQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2182172-2182900 Pseudomonas sp. VLB120, complete genome
ATGCTGCACGCCAACCCCTGGCGCAGTGCGGCGCGCACAGACGCCGGCAAGGTGCGCGCCCGCAACGAGG
ATGCATTTCTGGATTGCCCGCAGCATGGGTTGTGGGCTGTAGCGGATGGTATGGGAGGACATGAGGATGG
CGATGTCGCCAGCCAGATGATCGTGGCCAGCCTGGCTGAACTGGCCCCTGCCGCCAGTTTCGACGAGCGT
GTGGTCGCGGTCCGCCAATGCCTGCACTGGATCAATCGCCGCCTGGGCCAGGAGCTGACAGTGAGCGTCG
AGGGCCACGCGCGAATCATCGGAAGCACAGTGGTCACGTTACTGCTTGAAGGCCGCCGTGGTGCATGCGT
GTGGGCCGGCGACAGCCGTTGCTACCTGTGGCGTGGGCATCGGCTGTACCAGCTGACCCGCGATCATTCG
CTTGCGCAGCAATTGATCGACCAGCAGCGCATGAGCGCCGAGCAGGCCCGTGGCCACCCCTCGGCACGCG
CACTGACCCGTGCGGTGGGCGCCAGTGCCGAGCTCAAGCTGGAGGTGCTGGAGTTCGAAGCGTTGCCGGG
CGATGTGTTCCTCCTGTGCAGCGACGGTCTCTACGACAGCCTTCAAAGCGATGGTCTCGGCCACGCCCTG
GACCTTGCGTCGCCCGCCGATGCCTTGCAGCGACTGTTTGCTACTGCACTGGGCGGTGCGGCGAAAGACA
ACCTGACCGCAGTGGTGATCCATCAATGA
 Primer design