SecReT6
Protein ID: 557222696
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09940
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2182897..2183964 [+]
Productserine-threonine kinase Stk1
NoteStk1
UniProt IDU5VDB6
KEGG IDpsv:PVLB_09940
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 2.40E-36, Aligned region: 72..325
Pkinase_Tyr [PF07714], Evalue: 1.20E-23, Aligned region: 74..327
APH [PF01636], Evalue: 2.30E-05, Aligned region: 61..225
APH [PF01636], Evalue: 2.30E-05, Aligned region: 317..317
Protein Sequence: 355 a.a.     [Download]
>gi|557222696|ref|YP_008762911.1| serine-threonine kinase Stk1 [Pseudomonas sp. VLB120]
MSGDALDILDALEQGGDATYFSFTQPAGEPDRGSNGKGRRKRRGKGRAAEPLPAIPAAVDVLPVPELLAG
RYRLERLLGAGGMGLVYRARDLLQESYGDPQPLLAVKLMSDQLAASADANALLFNEYALTSRLRHPNLVR
LHGFAVDPQCGRAFISMELMRGRALDRVLCDQPLGLAWAEVREIAVPLLDALACVHGQGVVHGDIKPSNV
MLGDDGVRLFDFGLGMAVEGPLARLPHLSYGRFEAWTPAYAAPELFEGSNPSRASDLYAVACVLYELACG
RHPFERVPSIKVRDQALSSRLSVPLGMPAKAWSALRVALAFDPEQRRVSAAQLRDAFAAQGLWARLRSMR
NTQSS
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2182897-2183964 Pseudomonas sp. VLB120, complete genome
ATGAGCGGCGACGCACTGGATATACTCGATGCCCTGGAGCAAGGTGGCGACGCCACCTACTTTTCCTTCA
CCCAGCCGGCCGGCGAGCCGGATCGGGGCAGCAATGGCAAGGGGCGGCGCAAGCGCCGTGGCAAGGGCAG
GGCGGCAGAACCGTTGCCTGCAATCCCGGCAGCCGTCGACGTGTTGCCTGTGCCCGAGCTGTTGGCCGGC
CGCTATCGCCTCGAGCGGCTGCTGGGGGCTGGCGGCATGGGCCTGGTGTATCGCGCTCGCGACTTGTTGC
AGGAAAGCTACGGTGATCCGCAACCGTTGTTGGCGGTCAAGCTGATGAGCGACCAACTGGCTGCCTCGGC
AGACGCCAACGCATTGCTGTTCAACGAATACGCGCTTACCAGCCGCTTGCGGCACCCCAACCTGGTGCGG
TTGCATGGTTTCGCTGTCGATCCGCAATGCGGGCGCGCCTTCATCAGCATGGAGTTGATGCGTGGTCGTG
CGCTTGACCGCGTACTCTGCGACCAGCCCCTGGGCCTGGCGTGGGCAGAGGTGCGTGAAATAGCCGTGCC
GCTGCTCGACGCCCTGGCCTGTGTACACGGCCAAGGGGTGGTGCATGGCGATATCAAACCCAGCAATGTG
ATGCTCGGCGACGATGGCGTGCGTCTGTTCGACTTTGGCCTGGGCATGGCCGTGGAAGGGCCACTGGCCA
GGTTGCCGCATTTGAGCTACGGCCGTTTCGAAGCCTGGACACCGGCCTATGCAGCGCCGGAGTTGTTCGA
GGGCAGTAATCCCAGCAGGGCCAGCGACCTGTATGCCGTTGCCTGCGTATTGTATGAGCTGGCCTGCGGC
CGTCATCCCTTCGAGCGTGTACCCTCGATCAAGGTCCGCGACCAGGCGCTGAGCTCGCGGCTTTCGGTGC
CGCTTGGCATGCCGGCCAAGGCCTGGAGCGCATTGCGTGTGGCGCTGGCGTTCGACCCCGAGCAGCGCCG
CGTGAGTGCGGCGCAGTTGCGTGATGCCTTTGCCGCCCAAGGACTGTGGGCGCGGCTCAGGAGCATGCGC
AACACTCAGTCTTCCTGA
 Primer design