SecReT6
Protein ID: 558666123
SecReT6 ID870
T6SS typei4a
Gene symbol-
Locus tagPA1R_gp0161
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]191501..195316 [-]
ProductIcmF-related protein
NoteTssM
UniProt IDU6AND5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.00E-34, Aligned region: 114..354
Protein Sequence: 1271 a.a.     [Download]
>gi|558666123|ref|YP_008802833.1| IcmF-related protein [Pseudomonas aeruginosa PA1R]
MSGATLFMLVLLLVLLALLLGALGWWWRTRGGTEIRSFYAAVRQMEREQGWQGRYEAPWLLMLGNETEGE
QLCATWRLLPVARPAWFGRWWSDGEGAILLVPESVFLPDEGLRRQSGAWLRLLRLFLRLRGRRALDGVVW
NIPLARLQDGEQAANLGLAARRRYVELTQRLGLSLPVYVVITGLEDLPGFQELLAALPEEARERALGWSS
PFAAEAAWQSRWCEQALEEITATLTESIVELGTLRGQVDNELYCLPPRLESLRGSLQALLEPVFQGNARG
EAPRFRGLYLSGSEAAGAAADDVLPAVDAPRRRSSFASQLWARRILAEEGLAQAVPRILQLRQRWQRGIG
LAALCLCLLWGGLMTWVWRDALRDAGELSQLLHGASERYQPLDDDTRRAAQVRQNVQAWWQLVSQAPRWR
FTSLAFPSSWFSSLDARIDNAYRRVSERLLVRPLRSLLEGEASDLRAIRSDGQPGLKEGDDPSQWKDYLA
AKDLVARATTLEHHNRLFAQAIDNRRTPLDDLLQLSNDALGSSYNAGSLARLAYYNRTLFAERPADLAAL
DLGRVAATAADNFHDLMARWLNAYFLTDSLERTGNALTQELAQLGQERDATAAQLLGIGELINHLQQQVN
RINLIWGNGVGQDLVPGYQNLLKSAQQSSLLGNRVEELQNLTVQLQQQFRSEWIAPPEAAGDGLLVKQGA
TLKLADDLLGLKRAIDDLKTKDFVSVALADKTLADHSLLSIDDIGVTQALSFFNDFTGYYESTLPSLNPR
YRYSVLHAAASAATEAMWQSLGPRSRSLASRNASRFDVQVKQVQVLQAALLELQDLQAGARLLLSLNALA
VADIGQALRDIDEQAVLREPVDFSRWSGAPNFGLQMFRAQDSAELKQSLNSQFNAMAAVAERHAPALEWL
QAQQSSLATADYNAFVRFSALNAELQKFKADNPASTAAQLAKLVGNDFNQMDIGSCADILNGVLLPSSRS
DLATRLVDLRQGALGRCQSLQQQQAAQAWKDLADYFNQYLAGRFPFAYSLEAADAEPGRVRHLLKLMETR
LPQVREGLAQVRSPDLPAAEDFVRRLEQAQRWLGPLFERDKSGLLGVALDIDWRSDRSLERGADQVIAWS
LYSGDQESRFPGAQDKGLTWNVGDPLKIMLRWAKNGSQRPADDPRQASLAVADLEAGWSYQGSWALLRMM
RAHFSRQRPPNVDYTEFPLVLQLPVYAPYSPENEARMFLRLSLMSLGGKTPLSIQPLPVRAPQSPFATLL
PATVASTGGTP
 
Nucleotide Sequence: 3816 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c195316-191501 Pseudomonas aeruginosa PA1R, complete genome
ATGAGCGGCGCGACCCTGTTCATGCTGGTTCTCCTCCTGGTGCTGCTGGCGCTGCTGCTGGGGGCGCTGG
GCTGGTGGTGGCGGACCCGGGGCGGTACGGAGATCCGCAGCTTCTACGCGGCGGTCCGGCAGATGGAGCG
CGAGCAGGGCTGGCAGGGCCGCTACGAAGCGCCCTGGCTGCTGATGCTCGGCAACGAGACCGAGGGCGAG
CAGTTGTGCGCCACCTGGCGCCTGCTGCCGGTGGCGCGCCCGGCCTGGTTCGGCCGCTGGTGGTCGGACG
GCGAGGGGGCGATCCTGCTGGTGCCCGAGTCGGTGTTCCTGCCCGACGAGGGCCTGCGCCGGCAAAGCGG
CGCCTGGCTGCGCCTGTTGCGTCTGTTCCTGCGCCTGCGTGGCAGGCGCGCGCTGGACGGAGTGGTCTGG
AACATTCCGCTGGCGCGGCTGCAGGATGGCGAGCAGGCGGCCAACCTCGGCCTCGCCGCGCGCCGTCGCT
ACGTGGAACTGACCCAGCGCCTTGGCCTGAGCCTGCCGGTTTACGTGGTGATCACTGGCCTGGAAGACCT
GCCTGGCTTCCAGGAACTTCTCGCGGCGCTGCCCGAGGAGGCGCGCGAGCGCGCCCTCGGCTGGTCCTCG
CCGTTCGCCGCCGAAGCGGCCTGGCAGTCGCGCTGGTGCGAGCAGGCGCTGGAGGAAATCACCGCCACCC
TGACCGAGTCGATCGTCGAACTCGGTACCTTGCGCGGCCAGGTGGACAATGAGCTGTATTGCCTGCCGCC
ACGCCTGGAAAGCCTCCGCGGTTCGTTGCAGGCGCTGCTCGAACCGGTCTTCCAGGGCAACGCCAGGGGC
GAGGCGCCGCGCTTTCGCGGTCTCTACCTGAGCGGCAGCGAGGCGGCGGGCGCGGCAGCCGACGATGTCC
TGCCGGCGGTCGACGCGCCGCGTCGGCGCAGCAGCTTCGCCAGCCAACTGTGGGCACGGCGGATCCTTGC
CGAGGAAGGCCTGGCCCAGGCGGTGCCGCGCATCCTCCAGCTGCGTCAGCGCTGGCAGCGCGGGATCGGC
CTCGCCGCGTTGTGCCTGTGCCTGCTCTGGGGCGGCCTGATGACCTGGGTCTGGCGCGACGCGCTGCGCG
ACGCCGGTGAACTGTCGCAATTGCTGCATGGCGCCAGTGAGCGCTACCAGCCGCTCGACGACGACACTCG
GCGCGCCGCCCAGGTCCGGCAGAACGTCCAGGCCTGGTGGCAACTGGTGTCACAGGCGCCGCGCTGGCGC
TTCACTTCGCTGGCGTTTCCCAGTTCCTGGTTTTCCTCCCTGGATGCACGTATCGACAACGCGTATCGCC
GCGTTTCCGAGCGCCTGCTGGTGCGACCGCTGCGCAGCCTGCTGGAAGGCGAGGCGAGCGACCTGCGGGC
GATCCGCAGCGATGGCCAACCCGGCCTGAAGGAGGGCGACGACCCCAGCCAGTGGAAGGACTACCTGGCG
GCGAAGGACCTGGTCGCCCGCGCCACTACGCTGGAGCACCACAATCGCTTGTTCGCCCAGGCCATCGACA
ACCGCAGGACGCCGCTCGACGACCTTCTGCAACTGAGTAACGATGCCTTGGGCAGCAGCTACAACGCCGG
CAGCCTGGCGCGCCTGGCCTATTACAACCGCACGCTGTTCGCCGAGCGTCCGGCCGATCTCGCCGCCCTC
GACCTGGGCCGGGTCGCCGCCACGGCGGCGGATAACTTCCATGACCTGATGGCACGCTGGCTGAACGCCT
ACTTCCTCACCGACAGCCTGGAACGCACCGGCAATGCCCTGACCCAGGAACTCGCGCAGCTCGGCCAGGA
ACGAGACGCCACGGCGGCCCAGTTGCTGGGGATCGGCGAATTGATCAACCACCTGCAGCAACAGGTCAAC
CGCATCAACCTGATCTGGGGCAATGGCGTCGGCCAGGATCTCGTCCCTGGCTACCAGAACCTGCTCAAGA
GCGCCCAGCAAAGCAGCTTGCTGGGAAACCGCGTGGAGGAACTGCAGAACCTCACCGTGCAGTTGCAGCA
GCAGTTTCGCAGCGAATGGATCGCGCCTCCGGAGGCTGCCGGCGACGGCCTGCTGGTGAAACAGGGGGCG
ACGCTCAAGCTGGCCGATGACCTGCTCGGTCTGAAACGCGCCATCGATGACCTGAAGACCAAGGACTTCG
TCTCCGTGGCCCTGGCGGACAAGACACTGGCGGACCACTCCTTGCTGAGCATCGACGATATCGGCGTGAC
TCAGGCGTTGAGCTTCTTCAACGACTTCACCGGCTACTACGAGAGCACCCTGCCATCGCTCAACCCGCGC
TATCGCTATTCGGTCCTGCACGCCGCCGCCAGCGCGGCGACCGAGGCCATGTGGCAAAGCCTCGGGCCGC
GCAGTCGTAGCCTGGCCAGTCGCAATGCCTCGCGTTTCGACGTGCAGGTCAAGCAGGTCCAGGTGTTGCA
GGCGGCGCTGCTGGAGTTGCAGGACCTGCAGGCCGGCGCGCGCCTGCTGCTCAGCCTCAACGCGCTGGCC
GTGGCCGATATCGGCCAGGCCCTGCGCGACATCGACGAGCAGGCGGTGCTGCGCGAGCCGGTCGATTTCA
GCCGCTGGTCGGGCGCGCCGAATTTCGGCCTGCAGATGTTCCGCGCCCAGGACAGTGCCGAGCTGAAGCA
AAGCCTGAACAGCCAGTTCAATGCCATGGCGGCCGTCGCCGAACGCCACGCCCCGGCGCTGGAGTGGTTG
CAGGCGCAGCAATCCAGCCTGGCCACCGCCGACTACAACGCGTTCGTGCGCTTCAGCGCGCTCAACGCCG
AACTGCAGAAATTCAAGGCCGACAACCCGGCGAGCACCGCGGCGCAGTTGGCGAAGCTGGTGGGTAACGA
TTTCAACCAGATGGACATCGGCAGTTGCGCCGACATTCTCAACGGCGTGCTCCTGCCGTCCAGCCGCAGC
GACCTGGCGACGCGCCTGGTGGACCTGCGCCAGGGCGCGCTCGGGCGCTGCCAGTCGTTGCAACAGCAGC
AGGCGGCGCAGGCCTGGAAGGACCTCGCCGACTACTTCAACCAGTACCTCGCCGGACGCTTCCCGTTCGC
CTACAGCCTGGAAGCGGCCGATGCCGAGCCGGGGCGGGTGCGGCACCTGCTGAAACTGATGGAGACGCGC
TTGCCGCAGGTGCGCGAAGGGCTGGCCCAGGTTCGCTCGCCGGACCTGCCGGCCGCCGAGGACTTCGTCC
GCCGCCTGGAGCAGGCGCAGCGCTGGCTCGGCCCGCTGTTCGAGCGCGACAAGTCGGGCCTGCTCGGCGT
CGCCCTGGACATCGACTGGCGCAGCGACCGCAGCCTGGAACGCGGCGCCGACCAGGTGATCGCCTGGAGC
CTGTACTCGGGCGACCAGGAAAGCCGTTTCCCCGGCGCGCAGGACAAGGGCCTGACCTGGAATGTCGGCG
ATCCGCTGAAAATCATGCTGCGCTGGGCGAAGAACGGCTCGCAGCGTCCGGCAGACGACCCGCGCCAGGC
CAGCCTGGCGGTGGCCGACCTCGAGGCCGGCTGGAGCTACCAGGGCTCCTGGGCGCTGTTGCGCATGATG
CGCGCGCACTTCTCCCGGCAGCGCCCGCCGAACGTCGACTACACGGAGTTTCCGCTGGTCCTGCAACTGC
CGGTGTATGCGCCTTACAGCCCGGAAAACGAGGCGCGGATGTTCCTCCGCCTGTCGTTGATGAGCCTGGG
CGGCAAGACCCCGCTGTCCATCCAGCCGCTGCCGGTGCGCGCGCCGCAATCGCCGTTCGCGACGCTGTTG
CCGGCCACCGTCGCCAGCACCGGAGGTACCCCATGA
 Primer design