SecReT6
Protein ID: 558671130
SecReT6 ID872
T6SS typei1
Gene symbol-
Locus tagPA1R_gp5240
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]5828516..5828923 [+]
Producthypothetical protein
NoteTssE
UniProt IDU6B215
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-18, Aligned region: 24..114
Protein Sequence: 135 a.a.     [Download]
>gi|558671130|ref|YP_008807840.1| hypothetical protein PA1R_gp5240 [Pseudomonas aeruginosa PA1R]
MTGYGSLFERLNGDADKRVGWSREVSAMASVAAHLGKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDSLSQ
ARSAIEGFIEAYEPRLSNVRVVSLPRDNDQLRLAFSIEGLLEVEGFKRQVSFSACLDGSGQVTVS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|558665962|ref|NC_022806.1|:5828516-5828923 Pseudomonas aeruginosa PA1R, complete genome
ATGACCGGATACGGCAGCCTGTTCGAGCGCCTGAACGGCGACGCGGATAAGCGCGTCGGCTGGAGCCGCG
AGGTTTCCGCCATGGCGTCGGTGGCTGCCCATCTGGGCAAGATGCTCAGCACCCGGGCGGGCAGCGTGCA
GACGCTGTCCGACTACGGGTTGCCCGATCTCAACGACATGCGCCTGAGCCTGCACGACTCCCTGAGCCAG
GCCCGCTCGGCCATCGAAGGTTTCATCGAGGCTTACGAACCGCGCTTGAGCAACGTGCGTGTCGTTTCCC
TGCCACGCGACAACGACCAGCTCCGCCTGGCCTTCAGCATCGAAGGGTTGCTGGAGGTGGAGGGTTTCAA
GCGCCAGGTGAGTTTTTCCGCATGCCTGGATGGCAGCGGCCAAGTGACGGTCAGCTAA
 Primer design