SecReT6
Protein ID: 558671131
SecReT6 ID872
T6SS typei1
Gene symbol-
Locus tagPA1R_gp5241
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]5829261..5831048 [+]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDU6B4A2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-184, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|558671131|ref|YP_008807841.1| Protein ImpG/VasA [Pseudomonas aeruginosa PA1R]
MSFNHYYQSELTALRQLGRRFAERSPALAPFLGQVGRDPDVERLLEGFAFLTGRLRQKLDDELPELSHSM
MHLLWPNYMRPLPAFSILQFDPLTRPGGALRVERDTPVESRPVGEVACRFRTCYATEVLPLVLEALNYSV
TGEGALLGLRLAMNCDGHLGELGLSRLRLHLAGERYISQMLYLCLLRNLESIQLIPLDAHGRPLDGVAGK
PMSFRLTGERVQPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVDGLDLLGALPEETLKQVRG
LELRFDIRKSGIQRLHPTLENVKLYCTPVANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGVT
GWRPGGLGYQAYVPFESFEHDPSFDVPEARPHYSVRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTCT
NQNLPQRLRLGDICVACEGTPEFLGFRNITPATPSYAPPLNRDFLWKLISNMSLNYLSLANVDALKVILE
TYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRGLPLRGLRTELTIDPEGYIGEGDLFVFASVLNEF
FALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|558665962|ref|NC_022806.1|:5829261-5831048 Pseudomonas aeruginosa PA1R, complete genome
GTGTCCTTCAATCATTACTACCAGAGCGAACTCACCGCACTGCGCCAGCTGGGGCGCCGTTTCGCCGAGC
GTAGCCCGGCCCTGGCCCCGTTTCTCGGGCAGGTCGGACGCGATCCGGATGTCGAGCGCCTGCTCGAGGG
CTTTGCCTTCCTGACCGGGCGGTTGCGGCAGAAGCTGGACGACGAGTTGCCGGAACTCAGCCACTCGATG
ATGCACCTGCTGTGGCCGAACTATATGCGCCCGCTGCCGGCTTTCAGCATTCTCCAGTTCGACCCCCTGA
CCCGCCCGGGCGGGGCGCTGCGCGTGGAGCGCGATACGCCGGTCGAGAGCCGGCCGGTGGGCGAGGTCGC
CTGTCGCTTCCGTACCTGCTACGCCACCGAGGTCCTGCCGCTGGTGCTGGAGGCGCTCAACTATTCGGTG
ACCGGCGAAGGCGCGCTGCTCGGCCTGCGCCTGGCGATGAACTGCGACGGGCATCTCGGCGAGCTGGGCC
TGAGTCGGCTGCGCCTGCACCTGGCCGGCGAGCGCTACATCAGCCAGATGCTCTACCTGTGCCTGCTGCG
CAACCTGGAGAGCATCCAGCTGATTCCGCTGGACGCCCATGGGCGGCCGCTGGATGGCGTGGCCGGCAAG
CCGATGTCGTTCCGCCTGACGGGCGAGCGGGTGCAGCCGGTGGGTTTCGCCGAAGACGAGGCGTTGATTC
CCTATCCGCTGAATACCTTCCGTGGCTATCGCTACCTGCAGGAGTACTTCGCGTTCCAGGACAAGTTCCT
GTTCGTCGACGTGGATGGCCTTGACCTGCTCGGCGCGCTGCCCGAGGAAACCCTCAAGCAGGTCCGCGGC
CTCGAGTTGCGCTTCGATATCCGCAAGAGCGGCATCCAGCGCCTGCACCCGACGCTGGAGAACGTCAAGC
TGTACTGTACGCCGGTGGCCAACCTGTTCCGCCACGATGCGCTGCCGATCCGCCTCGACGGCAAGCAGGA
CGAGTACCTGCTGATGCCGGCCGAATACAGCCTGGAGGACTGCGGGGTGTTCTCGGTAGAAGGCGTCACT
GGCTGGCGGCCGGGCGGGCTCGGCTACCAGGCTTACGTACCGTTCGAGTCCTTCGAGCACGATCCCAGCT
TCGACGTTCCCGAAGCACGGCCCCACTACAGCGTCCGGCAACGGACCTCGTTGCTGCACGATGGCCTGGA
CACCTACCTGAGCTTCGGCATCCGCCATCCCGAGCAGATCGAGACGCTGTCGGTGGAACTGACCTGCACC
AACCAGAACCTGCCCCAACGGCTGCGCCTGGGCGATATCTGCGTCGCCTGCGAAGGCACGCCGGAGTTCC
TCGGTTTCCGCAATATCACCCCGGCGACGCCGAGCTACGCGCCGCCGCTGAACCGCGATTTCCTCTGGAA
ACTGATCAGCAACATGTCGCTCAACTACCTGTCGCTGGCCAACGTCGACGCACTCAAGGTGATCCTCGAA
ACCTACGACCTGCCGCGCTACTACGACCAGCATGCGGCGAAGGTCAGCAAGCGCCTGCTGGGCGGGCTCA
AGGCGGTCCGCCACGAGCATGTCGACCGCCTGCATCGGGGCCTGCCGCTGCGCGGCTTGCGTACCGAGCT
GACGATCGATCCGGAAGGCTACATCGGCGAGGGCGACCTGTTCGTGTTCGCTTCGGTTCTGAACGAATTT
TTCGCGCTTTACGCCAGCATCAACTCCTACCACGAGTTGCGGGTGAGGAGCACACAGGGAGACGTGTACC
AATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAA
 Primer design