SecReT6
Protein ID: 558671132
SecReT6 ID872
T6SS typei1
Gene symbol-
Locus tagPA1R_gp5242
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]5831012..5832019 [+]
ProductUncharacterized protein ImpH/VasB
NoteTssG
UniProt IDU6B4L4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-88, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|558671132|ref|YP_008807842.1| Uncharacterized protein ImpH/VasB [Pseudomonas aeruginosa PA1R]
METAHGFAAPAVSALARGIREYSLFQAVLLVMDRLREEYPGLGDEALYDQLEFQANPSLGFPGSDVDRVE
FFEERGMLRARLRFNLIGLFGASSPLPAFYSEQALGDSEEGNPTRNFLDLFHHRLHRLLLPIWRKYRYRV
SFQSGASDAFSAQLFALVGLGGEEIRKARELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELVAEQ
CIERRVAILEEQRNRLGLFNSQLGEDAVLGERVRDRSGKFRIHIRQLDWQRFHEFLPIGPGYQPLCALVR
FTLRDPLDYDIRLVLRHEEIREFRIGAQNACRLGWTSWLGRERADGVVTLGSKIH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|558665962|ref|NC_022806.1|:5831012-5832019 Pseudomonas aeruginosa PA1R, complete genome
ATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAAGCGCGCTGGCCCGGGGCATTCGCGAGTACTCGC
TGTTCCAGGCGGTCCTGCTGGTCATGGATCGCCTGCGCGAGGAATATCCCGGCCTGGGAGACGAGGCGCT
CTACGATCAGTTGGAATTCCAGGCCAATCCTAGCCTCGGTTTCCCGGGCAGCGATGTCGATCGGGTGGAG
TTCTTCGAAGAGCGCGGCATGCTGCGGGCGCGGCTGCGTTTCAACCTGATCGGCTTGTTCGGTGCCAGTT
CGCCGTTGCCGGCGTTCTACAGCGAGCAGGCTCTGGGCGACAGCGAGGAGGGCAATCCTACGCGGAACTT
CCTCGATCTCTTCCATCACCGCCTGCATCGGCTGCTGTTGCCGATCTGGCGCAAGTACCGCTACCGGGTG
AGCTTCCAGAGCGGCGCGAGCGATGCGTTCTCCGCTCAGTTGTTCGCCCTCGTCGGATTGGGCGGGGAAG
AGATCCGCAAGGCCAGGGAACTGAACTGGAAACGCCTGCTGCCCTACCTGGGCCTGCTCAGCCTGCGGGC
GCACTCGGCGGCCTTGATCGAGTCGGTGCTGCGCTACTACTTCAAGCATGCCGAACTGGTCGCCGAGCAG
TGTATCGAACGGCGCGTCGCGATCCTCGAAGAGCAGCGCAACCGGCTCGGCCTGTTCAACAGCCAGCTTG
GCGAAGACGCGGTGCTGGGCGAACGGGTCCGCGACCGCAGCGGCAAGTTCCGCATTCATATCCGCCAGCT
CGACTGGCAGCGCTTCCACGAGTTCCTGCCGATCGGTCCCGGCTACCAGCCGCTTTGCGCGCTGGTTCGC
TTCACCCTGCGCGACCCGCTCGACTACGACATCCGGCTGGTCTTGCGCCACGAGGAAATCCGCGAGTTCC
GCATCGGCGCGCAGAACGCCTGCCGCCTTGGCTGGACCAGCTGGCTGGGCCGGGAGCGCGCGGATGGCGT
GGTGACGCTGGGCAGCAAGATTCATTAA
 Primer design