SecReT6
Protein ID: 558671135
SecReT6 ID872
T6SS typei1
Gene symbol-
Locus tagPA1R_gp5245
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]5836428..5837621 [+]
ProductUncharacterized protein ImpI/VasC
NoteFha
UniProt IDU6B218
KEGG IDpaer:PA1R_gp5245
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.80E-14, Aligned region: 30..96
Protein Sequence: 397 a.a.     [Download]
>gi|558671135|ref|YP_008807845.1| Uncharacterized protein ImpI/VasC [Pseudomonas aeruginosa PA1R]
MELVLEMLSAKQFVPTELCSKTFGRNGGLIGRGGECDWAIPDRKRHLSKQHARVSYRNGAFYLTDTSSNG
IRAGNGSRLPHGEPQRIEQDSVFLLGDFEIRARLLREPDELAMDVGRPQPAGSIIPDDAFLALDPLQALD
QDGADAYELDDLSAIAQPSHEAGARADYARIDMESLVVPELVPAPAAPQEPVESPPPERDEAFWQRFGQA
LGVDLEGLDGAAREALAIDAAGLLRQCIGGLQQSLRTRSELKNELRLSLSTLRDTGKNPLRFSADAGEAL
GHLLRDGKPGQLSGEQAVARSFRDLQAHQVALLGASRAAVRATLEHFSPQQLALRFERDGRRPLLATSGS
RWRAYGRYHQSLCQDDDWSERLLARDFAQAYEEQVRLISTLYTEHQG
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|558665962|ref|NC_022806.1|:5836428-5837621 Pseudomonas aeruginosa PA1R, complete genome
ATGGAACTGGTATTGGAAATGCTCAGCGCCAAGCAATTCGTACCGACAGAGCTATGCAGCAAGACCTTCG
GCAGGAACGGCGGCCTCATCGGCCGCGGCGGTGAGTGCGATTGGGCGATTCCCGATCGCAAGCGGCACCT
GTCCAAGCAGCATGCGCGGGTCAGCTATCGCAACGGCGCGTTCTACCTGACCGACACCAGCAGCAACGGC
ATCCGCGCCGGCAACGGCAGCCGCCTGCCGCATGGCGAGCCGCAGCGCATCGAGCAGGACAGCGTCTTCC
TGCTCGGCGACTTCGAGATCCGCGCGCGGTTGCTGCGCGAGCCCGACGAGCTCGCCATGGACGTCGGGCG
GCCGCAGCCGGCGGGCAGCATCATTCCGGACGATGCCTTCCTGGCCCTCGATCCGTTGCAGGCGCTCGAC
CAGGACGGTGCAGATGCCTACGAACTCGACGACCTGAGCGCGATCGCCCAGCCCAGTCATGAGGCCGGGG
CGCGTGCGGACTACGCGCGGATCGACATGGAAAGCCTGGTCGTACCGGAGCTGGTGCCCGCCCCGGCGGC
TCCGCAGGAACCCGTGGAAAGTCCGCCTCCGGAACGCGACGAAGCCTTCTGGCAGCGTTTCGGCCAGGCG
CTCGGAGTGGACCTCGAAGGCCTCGACGGCGCTGCGCGCGAAGCGCTGGCGATCGACGCCGCCGGTTTGC
TGCGGCAGTGCATCGGCGGCTTGCAGCAGAGCCTGCGGACCCGCAGCGAACTGAAGAACGAACTGCGCCT
GTCGCTGAGCACGTTGCGCGATACCGGCAAGAATCCCTTGCGCTTCAGCGCCGATGCCGGCGAGGCGCTG
GGGCATCTGCTACGGGATGGCAAGCCTGGCCAGTTGAGTGGCGAACAGGCCGTCGCACGCAGTTTCCGCG
ACCTCCAGGCGCACCAGGTGGCGCTGCTCGGCGCCAGCCGGGCGGCGGTGCGCGCGACCCTCGAGCATTT
CTCGCCGCAGCAGCTGGCCCTGCGTTTCGAGCGCGACGGTCGCCGGCCGTTGCTGGCCACCTCGGGCAGC
CGCTGGCGTGCCTACGGTCGCTACCACCAGTCGCTATGCCAGGACGACGATTGGAGCGAGCGTCTGTTGG
CGCGTGATTTCGCCCAGGCCTACGAAGAGCAGGTTCGCCTGATTTCCACCCTCTACACCGAGCACCAAGG
ATGA
 Primer design