SecReT6
Protein ID: 558671136
SecReT6 ID872
T6SS typei1
Gene symbol-
Locus tagPA1R_gp5246
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]5837618..5838133 [+]
ProductType VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDU6B4A7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.40E-42, Aligned region: 22..157
Protein Sequence: 171 a.a.     [Download]
>gi|558671136|ref|YP_008807846.1| Type VI secretion lipoprotein/VasD [Pseudomonas aeruginosa PA1R]
MIAMSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHP
VAFENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVGEGSRYVGVLAAYRDLGEASWRYVVPV
TAKELTRVELKLGQKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 516 bp     [Download]
>gi|558665962|ref|NC_022806.1|:5837618-5838133 Pseudomonas aeruginosa PA1R, complete genome
ATGATCGCCATGTCTCGTCGCCCGATCCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGC
TGGCCGGCTGTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGA
GCGGGTCAATCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAACACCCG
GTGGCGTTCGAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGG
TGACCAGCGAGGAGCTGGAGCTGCGTCCCGGCGAGCGGGTCGAACTCAAGCTCAGCGTGGGGGAGGGGAG
CCGCTACGTGGGCGTGCTCGCCGCCTACCGTGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTC
ACGGCGAAAGAGCTGACCCGGGTAGAGCTGAAGCTGGGCCAGAAGGGCATCCTGAATGCCGGCGAACTGC
TCGGCAAGGCGGGTGACGCGCGATGA
 Primer design