SecReT6
Protein ID: 558671138
SecReT6 ID872
T6SS typei1
Gene symbol-
Locus tagPA1R_gp5248
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]5839464..5840333 [+]
ProductOuter membrane protein ImpK/VasF, OmpA/MotB domain protein
NoteTssL
UniProt IDU6B2S8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-68, Aligned region: 62..266
Protein Sequence: 289 a.a.     [Download]
>gi|558671138|ref|YP_008807848.1| Outer membrane protein ImpK/VasF, OmpA/MotB domain protein [Pseudomonas aeruginosa PA1R]
MIKEREYHEDEKTVLLDHQGQVPAQGPLTDFAEPPRFEQLEERMIYAARLRPGEAFNVSLSPLVAAASEL
LSEVVRLKHSTVLENLAALKERLTSAMKLFEFRAVQDGVENSQVMAARYVLCTVVDEAVVTTPWGNESEW
SKISLLSSFHNETFGGEKFFQLLDRLSKNPVKHLPMLELMYLCLALGFEGKYRVMARGVLDLDGISDALY
RQIRQLRGDVPRELSPHWQGLSDQRRGLVRIVPWWMVALFTLVCLVVMYSGFAWVLGEQRDTVLQPYQSL
DAAAGQPGS
 
Nucleotide Sequence: 870 bp     [Download]
>gi|558665962|ref|NC_022806.1|:5839464-5840333 Pseudomonas aeruginosa PA1R, complete genome
ATGATCAAGGAAAGGGAATACCACGAGGACGAGAAGACCGTCCTCCTCGATCACCAGGGACAGGTACCGG
CCCAGGGGCCGCTGACCGATTTCGCCGAACCGCCGCGCTTCGAGCAGCTCGAGGAGCGGATGATCTACGC
GGCGCGCCTGCGTCCGGGCGAGGCCTTCAACGTCAGCCTGAGCCCGCTGGTGGCGGCGGCTTCCGAACTG
CTTTCGGAAGTGGTCCGGCTCAAGCACAGCACCGTGCTGGAGAACCTTGCGGCGCTCAAGGAGCGGTTGA
CCTCCGCCATGAAGCTCTTCGAATTCCGCGCCGTGCAGGATGGCGTGGAAAACAGCCAGGTCATGGCGGC
GCGCTACGTGCTGTGCACGGTGGTCGACGAGGCGGTGGTGACCACCCCGTGGGGCAACGAAAGCGAATGG
TCGAAGATCAGCCTGCTGAGCAGCTTCCATAACGAGACCTTCGGCGGCGAGAAGTTCTTCCAGTTGCTCG
ACCGGCTGTCGAAGAACCCGGTCAAGCACCTGCCGATGCTGGAGCTGATGTACCTCTGCCTTGCCCTCGG
CTTCGAGGGCAAGTACCGGGTGATGGCTCGCGGCGTGCTTGACCTGGACGGTATTTCCGATGCGCTCTAC
CGGCAGATCCGCCAGTTGCGCGGCGACGTGCCGCGCGAACTGTCGCCGCACTGGCAGGGGCTCAGCGACC
AGCGTCGCGGCCTGGTGCGGATCGTGCCCTGGTGGATGGTGGCGCTGTTCACCCTGGTCTGCCTGGTGGT
GATGTATTCGGGATTCGCCTGGGTTCTCGGCGAACAACGCGACACGGTGCTGCAGCCTTACCAGTCGCTC
GATGCGGCGGCAGGACAGCCCGGTTCGTAA
 Primer design