SecReT6
Protein ID: 558671140
SecReT6 ID872
T6SS typei1
Gene symbol-
Locus tagPA1R_gp5250
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]5843864..5844592 [+]
ProductSerine/threonine protein phosphatase
NoteStp1
UniProt IDU6B221
KEGG IDpaer:PA1R_gp5250
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.10E-16, Aligned region: 19..204
PP2C [PF00481], Evalue: 3.50E-16, Aligned region: 31..234
SpoIIE [PF07228], Evalue: 5.70E-11, Aligned region: 35..241
Protein Sequence: 242 a.a.     [Download]
>gi|558671140|ref|YP_008807850.1| Serine/threonine protein phosphatase [Pseudomonas aeruginosa PA1R]
MQRTEPWRSAARTDRGKVRARNEDAFLDCPDRGLWAVADGMGGHQAGDLASRMIVTSLAELPARAGFDER
LNAMRQCLHWLNRRLGEELTLSAERGDRIIGSTVVALVVEGSRAACVWVGDSRCYLWRGQRLYQLSRDHS
LLQRLVDERRMDIEQARAYPSARALTRAVGASEQLVLDVLELEVHPGDVFLLCSDGLYEELSADALGRAL
SLASPQVAVERLFDGALSGAARDNLTAVVIRQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|558665962|ref|NC_022806.1|:5843864-5844592 Pseudomonas aeruginosa PA1R, complete genome
ATGCAACGCACCGAGCCCTGGCGCAGCGCGGCACGCACGGATCGCGGCAAGGTCCGCGCGCGCAACGAGG
ATGCCTTCCTGGACTGCCCGGATCGCGGGCTCTGGGCGGTCGCCGATGGCATGGGCGGGCACCAGGCCGG
CGACCTGGCCAGCCGGATGATCGTCACCAGCCTGGCGGAACTGCCGGCCCGGGCGGGATTCGACGAGCGC
CTGAACGCGATGCGCCAGTGCCTGCACTGGCTCAACCGGCGCCTGGGCGAGGAACTCACCCTCAGCGCCG
AACGCGGCGACAGGATCATCGGCAGTACGGTGGTGGCGCTGGTCGTGGAGGGTTCGCGGGCGGCCTGCGT
GTGGGTCGGCGACAGCCGCTGCTACCTGTGGCGCGGCCAGCGGCTGTACCAGCTGTCCCGCGACCACTCG
CTGTTGCAGCGACTGGTCGACGAACGGCGGATGGATATCGAGCAGGCCCGCGCCTATCCCTCGGCGCGCG
CGCTGACCCGTGCCGTCGGCGCCAGCGAACAACTGGTGCTGGACGTGTTGGAACTGGAGGTGCATCCCGG
TGATGTCTTCCTGCTCTGCAGCGACGGGCTCTACGAAGAGCTGAGCGCCGATGCGCTGGGTCGCGCGTTG
AGCCTGGCATCGCCGCAGGTGGCGGTGGAGCGGCTGTTCGACGGTGCCCTGAGCGGCGCCGCACGGGACA
ACCTGACGGCCGTGGTGATCCGCCAATGA
 Primer design