SecReT6
Protein ID: 558672475
SecReT6 ID873
T6SS typei4a
Gene symbol-
Locus tagPA1S_gp0162
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]195313..196071 [-]
ProductInner membrane protein DotU
NoteTssL
UniProt IDU6A677
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.60E-46, Aligned region: 16..229
Protein Sequence: 252 a.a.     [Download]
>gi|558672475|ref|YP_008809183.1| Inner membrane protein DotU [Pseudomonas aeruginosa PA1]
MPEGSAGPFSQAYQEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRRLWRSAFASVG
DAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQDKPLESHLYGSRQAGEYLPLAIKRLLDERAPASRDL
ANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQREADAADLGRRLEQPAAAPPRRLPVRAALPDG
FRLGLAVLGLVLLMSGIGHLFWRDIQHEMAAVTHLADAEQAP
 
Nucleotide Sequence: 759 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c196071-195313 Pseudomonas aeruginosa PA1, complete genome
ATGCCCGAAGGGAGTGCAGGGCCTTTTTCCCAGGCGTACCAGGAGCAGCCGCTCAGCACGGCATTCCGCC
AGGCCTGGCAGGAATGGCTGGAGGCCTGGGGCGCCCTCGACCGGGACGCCCAGGATGTGCCACGGATGGT
CGAGCGCGCCCTCGAACTGTCCACCCGCATCACCCGGCGTCTGTGGCGCAGCGCCTTCGCCAGCGTCGGC
GACGCGGCGGGCGTGCAGGTCAAGGCGATGGTCTATGCCTTCGTCGCCCTGGTCGACGAGACCCTGGTCT
TCAGCGCCTGGCCGGGGCAGGGCGCCTGGCAGGACAAACCGCTGGAGTCGCATCTCTACGGCAGTCGCCA
GGCGGGCGAATACCTGCCGCTGGCGATCAAGCGCCTGCTCGACGAGCGCGCCCCGGCCAGTCGCGACCTG
GCCAACGTCTACCTGCAATGCCTGATCCTCGGCTTCCGCGGTCGCCTGCGCGGGCCGCGCGGCGAGGCGC
TGCACGAGAAGTGGCGGCAGGCGTTGTTCGCCTTCGCCTGGCAGCGCGAGGCGGACGCCGCCGACCTCGG
CCGTCGCCTTGAGCAGCCCGCCGCTGCGCCGCCACGGCGTCTGCCGGTGCGCGCAGCGCTGCCGGACGGC
TTCCGCCTGGGCCTGGCGGTGCTCGGGCTGGTGCTGTTGATGAGCGGTATCGGACACCTGTTCTGGCGCG
ACATCCAGCACGAAATGGCGGCGGTGACCCACCTGGCCGATGCGGAGCAGGCGCCATGA
 Primer design