SecReT6
Protein ID: 558672476
SecReT6 ID873
T6SS typei4a
Gene symbol-
Locus tagPA1S_gp0163
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]196089..197381 [-]
ProductUncharacterized protein ImpJ/VasE
NoteTssK
UniProt IDU6A8C5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.00E-69, Aligned region: 7..398
Protein Sequence: 430 a.a.     [Download]
>gi|558672476|ref|YP_008809184.1| Uncharacterized protein ImpJ/VasE [Pseudomonas aeruginosa PA1]
MQLLPQHFQLQGLRAEALAARIGQACNPWFWGVTALELDPSALCAGQVRVLHLEAILPDGLPVSVQAGVD
APLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEHPEPITVWRASLRL
VGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLILPESPLGRRVQSLCARAREKALFLGGRLRLAQQA
GNQDDAVEIRRQLAALWTRLPEVEGLLASRAASPLALHGSLLGLAGAWAALDPLAGVPAFEALDFLDLRR
GYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGEQAAADWLERAIVA
SDPHLPLLARQRMSGLPRQPMNRQEQVAYSVGDDTRLFVVQGAGDWFDAGQPLRIVAPVSGVASSPWQIV
LFVADGSDNT
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c197381-196089 Pseudomonas aeruginosa PA1, complete genome
ATGCAACTGCTTCCCCAGCATTTCCAGTTGCAGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCATCGGAC
AGGCCTGCAACCCTTGGTTCTGGGGAGTGACCGCCCTGGAACTGGACCCCTCTGCGTTGTGCGCCGGCCA
AGTGCGGGTCCTGCACCTCGAAGCGATCCTGCCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGAC
GCGCCGCTGGAGTTCGATCTGGAGACAGCGCTGGCGGCCGCCGAAGGGCCGCTGCTGAACGTCCACCTGG
CGGTCAGTCCGCTGTGGCGGGCGGGTCAGTTGCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGC
GCCGCTGCCGGACCTGGCCAGCGGCGAGCACCCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTG
GTCGGCGACGACGGCAAGGCCGACTCCGTGTGCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCT
ACGTCAGCCTGCCCTACGTCCCGCCGACGCCACTGATCCTGCCGGAGTCGCCCCTGGGCAGACGCGTGCA
GTCGCTCTGCGCGCGGGCCCGGGAGAAGGCGCTGTTCCTCGGCGGGCGCCTGCGCCTGGCGCAGCAGGCG
GGCAACCAGGACGACGCGGTGGAAATCCGTCGCCAGCTTGCCGCGCTCTGGACCCGCCTGCCGGAGGTCG
AAGGCCTGCTGGCAAGCCGTGCGGCCTCGCCGCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGTGC
CTGGGCGGCGCTCGATCCGCTGGCCGGCGTGCCGGCCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGT
GGCTACGAGCCGCTGCTGGACTGGTTGGAGCGCGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGC
CGTTCGAGCAGGAGGAACAGGTATTTTCCGTGCGCCTGCCCGATCCGGCGCCGCGTCAGCGCCTGGTGGT
CGGCCTGCGGATGCCCGCCGGCGCCGGCGAACAGGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCC
TCCGACCCGCACCTGCCGTTGCTCGCCCGGCAACGCATGAGCGGGCTGCCGCGGCAGCCGATGAATCGCC
AGGAACAGGTGGCCTACAGCGTTGGCGACGACACCCGTTTGTTCGTCGTGCAGGGTGCCGGCGACTGGTT
CGATGCCGGCCAGCCGCTGCGCATCGTCGCGCCGGTCAGCGGGGTCGCCAGCAGTCCCTGGCAGATCGTG
CTGTTCGTCGCCGACGGCAGCGACAACACCTAG
 Primer design