SecReT6
Protein ID: 558672478
SecReT6 ID873
T6SS typei4a
Gene symbol-
Locus tagPA1S_gp0165
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]198165..198710 [+]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDU6A6R8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.30E-52, Aligned region: 9..161
Protein Sequence: 181 a.a.     [Download]
>gi|558672478|ref|YP_008809186.1| Uncharacterized protein ImpB [Pseudomonas aeruginosa PA1]
MAESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILADLSGKPDTPPAKLVERRFVDIDRDNFNE
ILSSISPRATLQVDNTISGDDSKLNVELRFNHIEDFDPVNLVKQVVPLRRLFEARQRLRDLLTKLDGNDD
LDQLLQDVVANTEGLQEIKAARPEAEAAPAGDSEPPADQPA
 
Nucleotide Sequence: 546 bp     [Download]
>gi|558672313|ref|NC_022808.1|:198165-198710 Pseudomonas aeruginosa PA1, complete genome
ATGGCCGAGAGTACGCAGCACAAGCTGGACCGGGTGCGCCCGCCGCGCGTGCAGATCACCTACGACGTCG
AGATCGGCAACGCCATCGAGAAGAAGGAGCTGCCCCTGGTGGTCGGCATCCTCGCCGACCTCTCCGGCAA
GCCGGATACCCCGCCGGCGAAGCTGGTCGAACGGCGTTTCGTCGACATCGACCGCGACAACTTCAACGAG
ATCCTCTCCTCCATCTCTCCCCGCGCCACCCTGCAGGTCGACAACACCATCAGCGGCGACGACAGCAAGC
TGAACGTCGAGCTGCGCTTCAACCACATCGAGGACTTCGACCCGGTCAACCTGGTGAAGCAGGTGGTCCC
GTTGCGTCGCCTGTTCGAAGCGCGCCAGCGCCTGCGCGACCTGCTGACCAAGCTCGACGGCAACGACGAC
CTCGACCAGTTGCTGCAGGACGTGGTGGCCAACACCGAAGGCCTGCAGGAAATCAAAGCGGCCCGCCCGG
AAGCCGAAGCGGCCCCGGCCGGCGACAGCGAACCCCCGGCCGACCAGCCGGCCTGA
 Primer design