SecReT6
Protein ID: 558672481
SecReT6 ID873
T6SS typei4a
Gene symbol-
Locus tagPA1S_gp0168
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]200801..201226 [+]
ProductUncharacterized protein ImpF
NoteTssE
UniProt IDU6A8C9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.00E-19, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|558672481|ref|YP_008809189.1| Uncharacterized protein ImpF [Pseudomonas aeruginosa PA1]
MSGALPPLFERLSAEADERPAFDDRALAESVRGELLRLLNTRRPANARSGILAYGLADWTAVQRLRAEDR
RQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGSLRSGSRLTPALFVIEQGSDGLEVRHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|558672313|ref|NC_022808.1|:200801-201226 Pseudomonas aeruginosa PA1, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCGGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAACACACGGCGCCCGGCGAATGC
GCGCAGCGGCATCCTCGCCTACGGGCTCGCCGACTGGACCGCCGTGCAACGCCTGCGCGCCGAGGACCGG
CGCCAGCTGGCGCGCGAGGTGCGGGCAGCGGTCGAGCATTTCGAGCCGCGTCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGCAATCCGCAGCGCCTGCGTATCCAGCTCGGCGGCAGCCTGCGCAGCGGGTC
GCGCCTGACGCCTGCGCTATTCGTCATCGAACAGGGCAGCGATGGCCTCGAGGTGCGCCATGAGCGATTC
GATTGA
 Primer design