SecReT6
Protein ID: 558672487
SecReT6 ID873
T6SS typei4a
Gene symbol-
Locus tagPA1S_gp0174
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]208284..210290 [+]
ProductVgrG protein
NoteTssI
UniProt IDU6A908
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.70E-71, Aligned region: 47..322
Phage_base_V [PF04717], Evalue: 5.10E-23, Aligned region: 351..444
Gp5_C [PF06715], Evalue: 1.60E-15, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 1.60E-15, Aligned region: 536..557
Gp5_C [PF06715], Evalue: 1.60E-15, Aligned region: 560..583
Gp5_C [PF06715], Evalue: 1.60E-15, Aligned region: 641..654
Protein Sequence: 668 a.a.     [Download]
>gi|558672487|ref|YP_008809195.1| VgrG protein [Pseudomonas aeruginosa PA1]
MPRPTDSTTSLSLTASALAALFPERLAGEERLNALPGWELLGYSAIPLALDGAIATHLTATLHNDADQRP
LDGLVAEIRQLPGDASAERYQVLLRPWLWWLTLASNNRVFQNLATSDIVTQVFDQHGFSDYQLQLSGSYQ
PREYCVQYGESDLAFVSRLLEEDGIFWFFTHAAGKHTLVLADSNDAFPPIPNGPQVAYLGQGIGVRELQG
VRSAQYSLQAVSGTYSATDYEFTTPGTSLYSQAEAVSGAAGVYQHPGGYTAKAQGDSLTKQRIDGLRSQE
TRLIGESDCRWLVPGHWFTLSGHDDDSLNIDWVLTSVTHDASHAHYRNRFEAIPKATAYRPARVTPKPRM
HTQTALVVGKAGEEIWTDQYGRIKIQFPWDRDGKNDETSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVTF
IDGDPDRPLVTGCVYNGDNALPYALPDNQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDLNVN
VLNDSTASIGHDETLTVQNARTRTVKEGDETVTLEKGKRTVTIQTGSDSLDVKDTRTVTVGADQTHSTGG
NYSHKVSGNFELTVDGNLTIKVSGTLALQSGGSLTLKSDADLAAQAGTSLTSKAGTSLTNQAGTSLTNKA
GTSLTNDAGVSLTNKAGAEQTVDGGGMLTIKGGLVKVN
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|558672313|ref|NC_022808.1|:208284-210290 Pseudomonas aeruginosa PA1, complete genome
ATGCCCCGTCCCACCGATAGCACTACCAGCCTCTCCCTGACCGCCTCGGCGCTGGCAGCCCTGTTCCCGG
AGCGTCTGGCCGGGGAAGAACGCCTGAACGCACTGCCCGGTTGGGAACTGCTGGGCTACAGCGCCATCCC
CTTAGCCCTGGACGGCGCAATCGCCACCCATCTCACCGCCACCCTGCACAACGACGCCGACCAGCGTCCG
CTCGACGGCCTGGTCGCGGAGATCCGCCAACTCCCCGGCGATGCCAGCGCCGAGCGCTACCAGGTGCTGT
TGCGCCCCTGGCTCTGGTGGCTGACGCTGGCCAGCAACAACCGGGTGTTCCAGAACCTGGCCACCAGCGA
CATCGTCACCCAGGTCTTCGACCAGCACGGCTTCAGCGACTACCAGTTGCAGCTCAGCGGCAGCTACCAG
CCCCGCGAATACTGCGTGCAGTACGGAGAGAGCGATCTCGCCTTCGTTTCGCGGCTGCTGGAGGAAGACG
GCATCTTCTGGTTCTTCACCCATGCCGCCGGCAAGCACACCCTGGTGCTGGCCGACAGCAACGACGCCTT
CCCGCCGATTCCCAACGGCCCGCAAGTGGCCTACCTGGGCCAAGGAATCGGCGTGCGCGAGTTGCAGGGC
GTGCGTTCGGCGCAGTACAGCCTCCAGGCGGTATCCGGGACCTACAGCGCCACCGACTACGAGTTCACCA
CCCCGGGCACCTCGCTGTACTCCCAGGCCGAGGCGGTTTCCGGCGCCGCCGGCGTCTACCAGCACCCCGG
CGGCTACACCGCCAAGGCCCAGGGCGACAGCCTGACCAAGCAACGCATCGACGGCCTGCGCAGCCAGGAG
ACGCGCCTGATCGGCGAGAGCGACTGCCGCTGGCTGGTGCCCGGCCACTGGTTCACCCTCAGCGGGCATG
ACGACGATTCGCTGAATATCGACTGGGTGCTGACCTCGGTCACCCATGACGCCAGTCACGCGCACTACCG
CAACCGCTTCGAGGCGATCCCCAAGGCCACCGCCTACCGCCCCGCGCGGGTCACGCCCAAGCCGCGCATG
CACACCCAGACCGCCCTGGTGGTGGGCAAGGCCGGCGAGGAGATCTGGACCGACCAGTACGGCCGGATCA
AGATCCAGTTCCCCTGGGACCGCGACGGCAAGAACGACGAGACCTCCTCCTGCTGGGTGCGCGTGGTGCT
GCCCTGGAGCGGCAAGGGCTTCGGCATGCAGTTCGTGCCGCGCATCGGCCAGGAAGTGATCGTCACCTTC
ATCGACGGCGACCCGGACCGCCCGCTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCCTGCCCTACG
CGCTGCCGGACAACCAGACGCAGTCCGGGATCAAGACCAACTCGTCGAAGGGCGGCGGCGGTTTCAACGA
GCTGCGCTTCGAGGACAAGAAGGACGCCGAGGAAGTCTTCCTCCAGGCGCAGAAGGACCTCAACGTCAAC
GTGCTCAACGACAGCACCGCCAGCATCGGCCACGACGAGACCCTGACGGTGCAGAACGCCCGCACCCGCA
CGGTGAAGGAAGGCGACGAGACCGTCACCCTGGAGAAAGGCAAGCGCACGGTGACCATCCAGACCGGCAG
CGACAGTCTGGATGTGAAGGACACGCGCACGGTGACGGTGGGCGCCGACCAGACCCACAGCACCGGCGGC
AACTACAGCCACAAGGTCAGCGGCAACTTCGAGCTGACGGTGGACGGCAACCTGACCATCAAGGTCAGCG
GCACCCTCGCCCTGCAGAGCGGCGGCAGCCTGACCCTGAAGAGCGACGCCGACCTCGCCGCCCAGGCTGG
CACCTCGCTGACCAGCAAGGCCGGGACGTCGCTGACCAACCAGGCCGGCACCTCCCTCACCAACAAGGCC
GGCACCAGCCTGACCAACGATGCCGGCGTCAGCCTGACCAACAAGGCCGGCGCCGAACAGACGGTGGACG
GCGGCGGCATGCTGACCATCAAGGGCGGCCTGGTAAAGGTCAACTGA
 Primer design