SecReT6
Protein ID: 558675846
SecReT6 ID874
T6SS typei3
Gene symbol-
Locus tagPA1S_gp3591
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]4020263..4023796 [-]
ProductIcmF-related protein
NoteTssM
UniProt IDU6AHZ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-98, Aligned region: 86..127
ImcF-related_N [PF14331], Evalue: 3.50E-98, Aligned region: 192..455
IcmF-related [PF06761], Evalue: 2.50E-92, Aligned region: 504..799
DUF1215 [PF06744], Evalue: 2.20E-40, Aligned region: 71..105
DUF1215 [PF06744], Evalue: 2.20E-40, Aligned region: 694..726
DUF1215 [PF06744], Evalue: 2.20E-40, Aligned region: 915..1036
AAA_10 [PF12846], Evalue: 0.0014, Aligned region: 130..287
AAA_10 [PF12846], Evalue: 0.0014, Aligned region: 598..683
AAA_16 [PF13191], Evalue: 0.0058, Aligned region: 127..255
AAA_16 [PF13191], Evalue: 0.0058, Aligned region: 594..645
AAA_16 [PF13191], Evalue: 0.0058, Aligned region: 777..843
Protein Sequence: 1177 a.a.     [Download]
>gi|558675846|ref|YP_008812554.1| IcmF-related protein [Pseudomonas aeruginosa PA1]
MKGFLNFFARWVVPVLGLLALSLIIWFLGPLLRLGNYEPLASATSRWVLIVLLFLVWIGFRVLRIVQARR
NAAKVMQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSERRNLYELPWYVIIGPPGSGKT
TALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKT
QRKRRPIDGAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDS
LNREERAQVWGMTFALDDGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAAL
RECLGEFLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIER
LFREVAFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGI
ESLSPAQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTRIEEQL
RSGGSSDFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSAR
LDQDLVEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTY
RGYREVFLTASLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNVT
QAADVLRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEQGAREQ
PQQADSDPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNALYVQVSAMAGASGDSLLGDAKNQVAAAAS
RVALSAERQPPVVQGLVKNVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSSRDATLED
FGHFFGAGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPAV
RFELKPVTMDAAISQFILDLDGQQLTYDHGPARPVAMQWPSANGLGVVRLTVTPPPSSGRSGLTLEGPWA
WFRLLDQSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL
 
Nucleotide Sequence: 3534 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c4023796-4020263 Pseudomonas aeruginosa PA1, complete genome
ATGAAAGGCTTCCTCAACTTCTTCGCGCGCTGGGTGGTGCCGGTGCTCGGCCTGCTCGCCCTGAGCCTGA
TCATCTGGTTCCTCGGCCCGCTGCTGCGCCTGGGCAACTACGAACCGTTGGCCTCGGCGACCAGCCGCTG
GGTGCTGATCGTCCTGCTGTTCCTGGTCTGGATCGGCTTCCGCGTGCTGCGCATCGTGCAGGCCCGGCGC
AACGCGGCGAAGGTCATGCAGAGTCTCGCCGAGGTCAGCGCGCCGGACGCCGCCAGCGTCGCCACCGCCG
AAGAGCTGGCGACCCTCAAGCAACGCATGGACGAGGCCCTGGCCCTGCTCAAGCGGGCCAAGTTGGGCGG
CAGCGAGCGGCGCAACCTGTACGAGTTGCCCTGGTACGTGATCATCGGCCCGCCCGGTTCGGGCAAGACC
ACCGCGCTGATGAATTCCGGCCTCGACTTCCCGCTCGCCGCGCAGATGGGCGCCGGGGCGATCCGCGGGG
TCGGCGGCACGCGCAACTGCGACTGGTGGTTCACCGACGAAGCGGTGCTGCTGGACACCGCCGGCCGCTA
TACCACCCAGGACAGCCACGCCCAGGTGGACAAGGCCGCCTGGCTGGGCTTCCTCGACCTGCTCAAGACC
CAGCGCAAGCGCCGCCCCATCGATGGCGCGTTCATCGCCATCAGCCTTTCCGACCTGCTGCTGGGCAGCG
ACGCCGAGCGCGCCGCCCATGCCCAGGCGATCCGCGCACGCATCCAGGAGCTGTACCAGCAGCTCGGGGT
GCGCTTCCCGATCTACGTGATGCTGACCAAGTTCGACCTGGTGCCGGGCTTCATGGAGTTCTTCGACAGC
CTGAACCGCGAGGAACGCGCGCAGGTCTGGGGGATGACCTTCGCCCTCGACGACGGCAAGAGCGCGGAAG
GCCCGCTGGCGGTGTTCGACAGCGAATTCGCCCTGCTCGAACAGCGTCTCACCGCGCGCCTGGTGGAACG
CCTGCAGCAGGAGCGCGACCCGGCGCGGCGCGACCTGGTCTACGGCTTCCCGCAGCAATTCGCCGCCCTG
CGCGAATGCCTCGGCGAGTTCCTCAACGGCGTGTTCAAGCCCAACCCCTACGAGGAACGCCCGCTGTTGC
GCGGCCTGTACTTCACCAGCGGAACCCAGGAAGGCAGTCCGATCGACCGTCTGATCGGCAGCATGGCGCA
GTCGATGAACCTCGACCGCCAGCACCTGGCGCGGCAGACCGGAACCGGGCGCAGCTACTTCATCGAGCGG
CTGTTCCGCGAAGTGGCGTTCGGCGAACGCGGCCTGGTCGGCACCAACCCGAAGGTCGAGCGCCGCCGCA
AGTGGCTGACCATCGGCGCGCTGAGCGCCACCGCGCTGGTGGTGCTGGCGGTGACGGCGGTATGGATCGC
CAGCTACCGCGCCAACCAGAGCTACATCGCCGCGGTCGACCAGCGCGTCGACCCGCTGGCGCGCGGCATC
GAGTCGCTGAGCCCGGCCCAGCGCGACGTCCTGGCCGTACTGCCACAGCTCAACGCGGTGCAGAATCTCG
CCGGCGACGCGCCGAGCTGGGCCGAAGGCTACGGGCTGTACCAGGGCGACATGCTCGGCGAGGAGTCCGC
CAGCGTCTACCGCAAGCTGCTGATCGCGGTGTTCGCCCCGCGCCTGGTGACCCGCATCGAGGAACAGTTG
CGCTCCGGCGGCAGCAGCGATTTCCTCTACGAGGGCCTGAAGGCCTACCTGATGCTCGGCAGCCCGGACC
ATTACGACGCCGACTTCATCAAGGCCTGGATCAGCCTCGACTGGGAACGCAACCTGCCGCGCGACCTCTC
GCCGGAACAGCGCCAGGCGCTGCACGCGCACCTCGACGCGTTGCTCGAACGACGGCCGCCGTCGGCGCGC
CTGGACCAGGACCTGGTCGAGGACCTGCGCCGCCAGTTGCAGCAACTGCCGGTGGCGCAGCGGGTCTACG
ACCGGGTCAAGCGGCAGAGGCTGCCCAAGGACGTGCCCGACTTCCGCATCAGCGACGCCGCCGGCCGCGA
CGCACCGCTGGTGTTCGCGCGCAAGAGCGGCAAGCCGCTCACCGACCCGCTCAGCGGCTTCTTCACCTAC
CGCGGCTATCGCGAGGTGTTCCTCACCGCCAGCCTCAGCCAGGCCGGCACCATCGCCGAGGAACAGTGGG
TGCTCGGGCGCGACCTGAACGATGCCGGCGATGCCGCCAACCTGGCCCTCGACGTGCGTCGCCTGTACTT
CCAGGACTACCTGCGGCAATGGGACGACCTGCTCGCCGACCTCACCGTGGTGCCGATCACCAACGTCACC
CAGGCCGCCGACGTGCTGCGCATTCTCTCCGGGCCGACCTCGCCGTTCCGCAAGCTGCTCGAGGCGGTGG
CCCGCGAGACCGACCTGCAGAAGGGCGACCGGCTGGTCGCCGCGCAAGTGAAGAAGGCCGCCGACGGCAC
CGTGGACAAGCTCAAGCAGCGCCTCGGCTCGCTGGTCGGCCAGGAGGAGGAGCAAGGCGCCCGCGAACAG
CCGCAGCAGGCCGACAGCGACCCGATCAGCGCCCACTTCGCCGAACTCAACAGCCTGGTCAGCAAGGGCG
AGGGCGGCAACGAGCCGGCGCCGATCGACAGCCTGCTGGAGGACATGAACGCGCTCTACGTACAGGTCAG
CGCCATGGCCGGAGCCAGCGGCGACTCGCTGCTCGGCGACGCCAAGAACCAGGTGGCCGCCGCCGCCTCG
CGCGTTGCCCTCAGCGCCGAGCGCCAGCCGCCGGTGGTCCAGGGACTGGTGAAGAACGTGGTCAACTCCA
CCACCAGCAGCATGATGGGCAGCGTGCGCAACCAGCTCAACGCGGCCTGGATCAGCGACGTGGTCAGCGT
CTACCGGCAGTCCCTGGCCGGGCGCTACCCGATCGCCGCCGGCAGCTCGCGCGACGCCACCCTGGAAGAC
TTCGGCCACTTCTTCGGTGCCGGTGGGGTGATGGACAGCTACTTCCGCCAGTACCTGCAACCCTACGTCG
ACACCTCCGCCAGCACCTGGCGCTGGCAGCCCGGCGCGGCGCAGAAGCTCGGCATCAACCCCGGCGTGCT
GCACACCTTCCAGCGCGCGGCGGCGATCCGCGACGCCTTCTTCCGCTCCGGCGGCATGCAGCCGGCGGTG
CGCTTCGAACTCAAGCCGGTGACCATGGACGCGGCGATCAGCCAGTTCATCCTCGACCTCGACGGCCAGC
AGTTGACCTACGACCATGGCCCCGCCCGCCCGGTGGCGATGCAGTGGCCGAGCGCCAACGGCCTCGGCGT
GGTCCGCCTGACGGTGACGCCGCCGCCCAGCAGCGGCCGTTCCGGCCTGACCCTGGAGGGCCCCTGGGCC
TGGTTCCGCCTGCTCGACCAGTCGGACCTGGAACGCGGCAACTCGCCGGACCGCTTCACCCTGCGGCTGC
GCATCGACGGCTCCAGCATCGCCTGCGAGCTGCGCGCCAGCAGCGCCTTCAACCCCTTCAAGAGCCGGGT
CGTGTCCGGCTTCAGCCTCCCGGAGCGCCTTTGA
 Primer design