SecReT6
Protein ID: 558677485
SecReT6 ID875
T6SS typei1
Gene symbol-
Locus tagPA1S_gp5244
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]5834670..5836181 [+]
ProductSigma-54 dependent transcriptional regulator
NoteSfa2
UniProt IDU6AKE6
KEGG IDpaep:PA1S_gp5244
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 1.90E-70, Aligned region: 195..362
Sigma54_activ_2 [PF14532], Evalue: 2.00E-22, Aligned region: 196..366
HTH_8 [PF02954], Evalue: 4.20E-13, Aligned region: 352..359
HTH_8 [PF02954], Evalue: 4.20E-13, Aligned region: 454..493
AAA_5 [PF07728], Evalue: 1.80E-07, Aligned region: 219..337
GAF_3 [PF13492], Evalue: 9.80E-05, Aligned region: 27..149
GAF_3 [PF13492], Evalue: 9.80E-05, Aligned region: 202..261
HTH_30 [PF13556], Evalue: 0.00027, Aligned region: 463..495
GAF_2 [PF13185], Evalue: 0.00047, Aligned region: 29..174
GAF_2 [PF13185], Evalue: 0.00047, Aligned region: 286..290
Protein Sequence: 503 a.a.     [Download]
>gi|558677485|ref|YP_008814193.1| Sigma-54 dependent transcriptional regulator [Pseudomonas aeruginosa PA1]
MFSRVPQPLAFAEALLAQFGALSRETDIAALLGGFARAVGELSGCELSQLYLLDQTHTALTLNAECRDGL
LQALEPSSLPADYTGEQLLQFALCQNRVVSLVDLPSRLHETGFLPAGEQPWLSLLCVPLVSPEKTVEGMV
VCATRRPLDLQGFAHPLGQLGSFVLAQLHLLQRLSQPSGEPQGPSSAPVVSGYGLIGRSAAMRETCRLIS
KVLHNPYTVLLQGETGTGKEVVARAIHEYGPRRAQAFVVQNCAAFPENLLESELFGYRKGAFTGAERDRP
GLFDAADGGTLLLDEIGDMPLSLQAKLLRVLQEGEIRPLGGNDTHKVDVRIIAATHRDLALLVRDGKFRE
DLYYRLAQFPIELPPLRQREGDALELARHFAERACVFLRRAPLGWSAEALELLDGYGFPGNVRELKGLVE
CAVLLCEGEVLLAEHFSLRAPPEAEAPLKLREHLEQIERDLLLACLRRNAGNQTLAARELGLPRRTLIYR
MGRLNIHFGDPRT
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|558672313|ref|NC_022808.1|:5834670-5836181 Pseudomonas aeruginosa PA1, complete genome
ATGTTCAGCCGCGTACCGCAACCCCTGGCCTTCGCCGAAGCCCTGCTCGCTCAGTTCGGCGCGCTGTCGC
GGGAAACCGACATCGCGGCCCTGCTGGGCGGTTTCGCACGCGCAGTCGGCGAACTCAGCGGCTGCGAGCT
GAGCCAGTTGTATCTGCTCGACCAGACCCATACCGCGCTCACCCTCAACGCCGAATGCCGGGACGGCCTG
TTGCAGGCGCTGGAGCCGTCGAGCCTGCCGGCGGACTACACCGGCGAGCAGTTGCTGCAGTTCGCCCTGT
GCCAGAACCGCGTGGTCAGTCTCGTCGACCTGCCGTCGCGGCTGCACGAGACCGGCTTCCTGCCGGCAGG
GGAGCAGCCCTGGCTGTCCCTGCTCTGCGTTCCGCTGGTGAGCCCGGAGAAAACGGTCGAGGGCATGGTG
GTCTGCGCTACCCGGCGCCCACTGGACCTGCAGGGATTCGCCCATCCACTGGGCCAGCTGGGCTCGTTCG
TGCTGGCCCAGCTGCATCTGCTGCAACGCCTCTCGCAACCCTCCGGCGAGCCGCAGGGACCGTCCAGCGC
ACCGGTGGTCAGCGGCTACGGGCTGATCGGCAGGAGCGCGGCGATGCGTGAGACCTGCCGCCTGATCAGC
AAGGTCCTGCACAACCCCTATACCGTGTTGCTGCAGGGCGAGACCGGCACCGGCAAGGAGGTGGTCGCAC
GGGCGATCCACGAGTACGGCCCGCGGCGTGCACAGGCGTTCGTGGTGCAGAACTGCGCGGCGTTTCCGGA
AAACCTGCTGGAAAGCGAGCTGTTCGGCTACCGCAAGGGCGCCTTTACCGGTGCCGAGCGCGATCGTCCC
GGGTTGTTCGATGCCGCGGATGGCGGAACCCTGCTGCTCGACGAAATCGGCGACATGCCCCTCTCGCTCC
AGGCCAAGCTGTTGCGCGTGTTGCAGGAAGGCGAGATTCGCCCGCTCGGCGGCAACGACACGCACAAGGT
CGATGTACGCATCATCGCCGCTACCCACCGTGACCTCGCCCTGCTGGTACGCGATGGCAAGTTCCGCGAA
GACCTCTACTACCGGCTGGCGCAGTTTCCCATCGAGTTGCCGCCGTTGCGCCAGCGCGAGGGCGACGCCC
TCGAACTGGCCCGGCATTTCGCCGAGCGCGCCTGCGTGTTCCTGCGCCGCGCGCCGCTGGGCTGGTCCGC
GGAAGCGCTGGAACTGCTCGACGGCTATGGCTTTCCCGGCAACGTTCGGGAGCTGAAGGGACTGGTGGAA
TGCGCGGTACTGCTCTGCGAAGGCGAGGTGCTGCTGGCCGAACACTTTTCCCTGCGCGCGCCCCCGGAAG
CGGAGGCGCCGCTCAAGCTGCGCGAGCATCTGGAGCAGATCGAACGGGACCTGCTGCTCGCCTGCCTGCG
CAGGAACGCTGGCAACCAGACCCTCGCCGCGCGCGAACTGGGTCTGCCGCGACGAACCCTGATCTATCGC
ATGGGACGCCTGAACATTCATTTCGGCGATCCCCGGACCTGA
 Primer design