SecReT6
Protein ID: 558677490
SecReT6 ID875
T6SS typei1
Gene symbol-
Locus tagPA1S_gp5249
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]5840349..5843864 [+]
ProductIcmF-related protein
NoteTssM
UniProt IDU6AKF1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.90E-76, Aligned region: 255..273
IcmF-related [PF06761], Evalue: 1.90E-76, Aligned region: 502..792
IcmF-related [PF06761], Evalue: 1.90E-76, Aligned region: 944..992
ImcF-related_N [PF14331], Evalue: 6.90E-75, Aligned region: 196..453
DUF1215 [PF06744], Evalue: 6.20E-34, Aligned region: 906..1030
Protein Sequence: 1171 a.a.     [Download]
>gi|558677490|ref|YP_008814198.1| IcmF-related protein [Pseudomonas aeruginosa PA1]
MKNFFKKVGAFLRKTWVWTLLLVLLAALLVWFVGPLLAVADYKFWESPTSRLLSISLMFLVWGLAMVFVS
WRAGVRRKAVEDSDEGQERLRRDGLIEDEQKELRSRFKDALRTLKTSSLYRGRSERWRNELPWYLLIGPQ
GSGKTSLLDFSGLEFPINRIDRKLTRDTAGTRYCDWYFADHGVLIDTAGRYLTQADGEVDGGAWATLLGL
LRKRRRARPLNGVMVSIPVETLLSDDEMALDTLARQVRARLQEIQQTLHLDLPVYLVLSKADQLLGFDEF
FDQLSREESDQVLGTSFGKEQNGTDVTVLRQAFEDLLRRLNSQVIMRIHQERDTLRRGRILDFPHQLGQI
GERLCLFVELAFTGNRYQRASRLRGFYLTSAPHLAQQLDEDTAGIGANLGIASGLLPTLRNGRSRFIHHL
LSQVIFPEANLAGLDRRERTRIHWGQRALYVGSLALLLLFGLLWAGGFSANHERLERLRELAQQWTQQRQ
ALGERDDAMAALKTLDSSYAATTVFPPKGEVSLHERAGLYQGNEVNPPLAAAYRRELETQLLPRVARMLE
AQIRGNMQNRERLLNSLRAYLMLNLRERRENGWLKDWVATDWSQRYAGNGTVQNGLNTHFARLLEQPFSY
PLNETLVAQARQVLRSESLANVVYRVLREQARSLPEYRFGQHLGPQAGLFVGTDYVIPGFYTQQGYQQYF
VVQGASLVNDILRDNWVLGEGSGISDMDLRRLMVELEQLYFRDYANFWSEAVGRLGLLPFNDAGEGADQV
SGLLAANSPILQLLLEVRENTRFPVLAESAEALAEASDKAAEKGGKLGKAAGKARDALAKNLPDTAKKSL
QRRFEPLHRLLDDNNGPAADLTPLLQALNELQLQLAGLARASQPEQAAFDMAKSRMGGQRDALSNLRNAS
ARLPRPLGGWFSVLAEDAWRLVLGDAYLYLNQRYQSELYGFYSKAINKRYPFNAHSASDVAVSDFREFFK
AQGVAERFFETYMRPFVSGDPGSYRLRSVDGYSLPMSKVYLDQMGTAQLIRQSFFAENPAEPQVRFRLEP
YTLDPGVSRAEFRFDGQSMEYRHGPIVPMSFKWPSDADGGRTSLVLEKMAGRPVGIERNTGPWSLFRLFD
LMQTEYLSGRDVMVLKADLGGLRANYLLLAQRTPNPFDLAVLRSFRMPVQL
 
Nucleotide Sequence: 3516 bp     [Download]
>gi|558672313|ref|NC_022808.1|:5840349-5843864 Pseudomonas aeruginosa PA1, complete genome
ATGAAAAACTTCTTCAAGAAAGTCGGCGCCTTCCTGCGCAAGACGTGGGTCTGGACGCTGTTGCTGGTAC
TCCTGGCGGCATTGCTGGTGTGGTTCGTCGGGCCGCTGCTGGCGGTCGCCGACTACAAGTTCTGGGAAAG
CCCGACCTCGCGGTTGCTGAGCATCAGCCTGATGTTCCTGGTCTGGGGGCTGGCGATGGTCTTCGTCAGC
TGGCGCGCCGGAGTGCGGCGCAAGGCCGTCGAGGACAGCGACGAGGGCCAGGAGCGCCTGCGCCGCGACG
GTCTGATCGAAGACGAACAGAAGGAATTGCGCAGCCGCTTCAAGGACGCCTTGCGCACCCTGAAGACCTC
CAGCCTGTACCGCGGCCGCAGCGAGCGCTGGCGCAACGAGCTGCCCTGGTACCTGCTGATCGGCCCGCAG
GGAAGCGGCAAGACCAGCCTGCTGGACTTTTCCGGACTGGAATTCCCGATCAACCGGATCGACCGCAAGC
TGACCCGCGACACCGCCGGCACGCGCTACTGCGACTGGTACTTCGCCGACCACGGCGTCCTGATCGACAC
CGCCGGGCGCTACCTGACCCAAGCCGACGGCGAGGTCGACGGGGGCGCCTGGGCGACCCTGCTCGGCCTG
TTGCGCAAGCGCCGCCGCGCACGGCCGCTGAATGGCGTGATGGTGTCGATTCCGGTGGAAACGTTGCTCA
GCGACGACGAGATGGCGCTGGATACGCTGGCTCGCCAGGTGCGCGCGCGCCTGCAGGAAATCCAGCAGAC
CCTGCACCTCGATCTGCCGGTCTACCTGGTGCTGAGCAAGGCCGACCAGTTGCTCGGCTTCGACGAGTTC
TTCGACCAGTTGAGCCGCGAGGAGAGCGACCAGGTTCTGGGCACCAGCTTCGGCAAGGAGCAGAACGGCA
CCGATGTGACGGTTCTGCGCCAGGCGTTCGAGGACCTTCTGCGACGTCTGAACAGCCAGGTGATCATGCG
CATCCACCAGGAGCGCGATACCCTGCGTCGCGGTCGCATCCTCGACTTCCCGCACCAGCTTGGCCAGATC
GGCGAGCGGTTGTGCCTGTTCGTCGAACTCGCCTTCACTGGCAATCGCTACCAGCGCGCCAGCCGCCTGC
GCGGCTTCTACCTGACCAGCGCGCCGCACCTGGCCCAGCAGCTGGATGAAGACACCGCCGGCATCGGCGC
CAACCTGGGGATCGCCAGCGGCCTGTTGCCGACCCTGCGCAACGGGCGCTCGCGCTTCATCCATCACCTG
CTGAGCCAGGTGATCTTCCCCGAGGCCAACCTGGCAGGTCTCGATCGCCGCGAACGCACGCGCATCCACT
GGGGCCAGCGCGCCCTGTACGTCGGTTCGCTGGCGCTCCTTCTGCTATTCGGCCTGCTCTGGGCTGGCGG
TTTCTCGGCCAACCACGAGCGCCTGGAGCGGCTACGCGAGCTGGCGCAGCAATGGACCCAGCAGCGCCAG
GCGCTTGGCGAGCGCGATGACGCCATGGCGGCGCTGAAGACGCTGGATAGCAGCTATGCGGCGACCACCG
TGTTTCCGCCCAAAGGGGAAGTCTCGCTGCACGAGCGCGCCGGGCTGTACCAGGGCAACGAGGTCAACCC
GCCGCTGGCCGCGGCCTATCGCCGCGAGCTGGAGACGCAACTGCTGCCGCGCGTGGCGCGGATGCTCGAA
GCGCAGATCCGCGGCAACATGCAGAATCGCGAACGCCTGCTCAACAGCCTGCGGGCCTACCTGATGCTGA
ATCTGCGCGAGCGCCGCGAGAACGGATGGCTCAAGGACTGGGTGGCTACCGACTGGTCGCAGCGCTATGC
CGGCAACGGCACCGTGCAGAATGGCCTGAACACGCATTTCGCCCGTCTGCTCGAGCAACCGTTCAGCTAT
CCGCTGAACGAGACCCTGGTGGCCCAGGCACGCCAGGTGCTGCGCAGCGAGTCCCTGGCCAACGTGGTCT
ACCGGGTGCTGCGCGAACAGGCGCGAAGCCTGCCCGAGTATCGCTTCGGCCAGCACCTGGGGCCGCAGGC
CGGTCTGTTCGTCGGCACCGACTACGTGATCCCGGGGTTCTACACCCAGCAGGGCTACCAGCAGTACTTC
GTGGTCCAGGGCGCCAGCCTGGTCAACGACATCCTTCGCGACAACTGGGTCCTGGGCGAGGGCAGCGGGA
TCAGCGACATGGACCTGCGGCGCCTGATGGTCGAACTCGAGCAGCTGTATTTCCGCGACTACGCGAACTT
CTGGAGCGAGGCGGTCGGACGCCTGGGCCTGCTGCCGTTCAACGATGCCGGCGAGGGCGCCGACCAGGTT
TCCGGGCTGCTCGCCGCCAACTCGCCGATCCTCCAGTTGTTGCTGGAGGTCCGTGAGAACACCCGTTTCC
CGGTCCTGGCGGAGAGCGCCGAGGCGCTGGCAGAGGCCAGCGACAAGGCTGCGGAAAAGGGCGGCAAGCT
GGGCAAGGCGGCCGGCAAGGCCAGGGACGCGTTGGCGAAGAACCTGCCGGATACCGCGAAGAAGTCCCTG
CAACGCCGCTTCGAGCCCCTGCATCGCCTGCTCGACGATAACAACGGCCCGGCGGCCGACCTCACCCCGC
TGTTGCAGGCGCTCAACGAGTTGCAGTTGCAACTCGCCGGACTGGCGCGCGCCAGCCAGCCGGAGCAGGC
GGCTTTCGACATGGCGAAGAGCCGCATGGGCGGCCAGCGCGATGCCCTGAGCAACCTGCGCAACGCCTCC
GCGCGACTGCCGCGACCGCTCGGCGGATGGTTCAGCGTGCTGGCCGAAGACGCCTGGCGGCTGGTCCTCG
GCGATGCCTACCTGTATCTCAACCAGCGCTACCAGAGCGAGCTGTACGGTTTCTACAGCAAGGCGATCAA
CAAGCGCTACCCGTTCAACGCGCACAGCGCCAGCGATGTCGCGGTCAGCGATTTCCGCGAGTTCTTCAAG
GCGCAGGGCGTCGCCGAACGCTTCTTCGAAACCTACATGCGGCCCTTCGTCAGCGGCGACCCGGGCAGTT
ACCGCCTGCGCAGCGTGGACGGTTACAGCCTGCCGATGTCCAAGGTCTATCTCGACCAGATGGGCACGGC
CCAGCTGATCCGCCAGAGCTTCTTCGCCGAGAACCCGGCCGAGCCACAGGTGCGCTTCCGCCTGGAGCCC
TATACCCTCGATCCTGGCGTCAGCCGCGCCGAGTTCCGTTTCGACGGTCAGTCCATGGAGTACCGCCACG
GCCCGATCGTGCCGATGTCGTTCAAGTGGCCCAGCGACGCCGACGGCGGCCGCACCAGCCTGGTGCTGGA
GAAGATGGCCGGACGACCGGTGGGAATCGAACGCAATACCGGGCCCTGGTCGCTGTTCAGGCTGTTCGAC
CTGATGCAGACCGAGTACCTCAGCGGGCGTGACGTGATGGTGCTCAAGGCCGACCTGGGCGGCCTGCGCG
CCAACTACCTGCTGCTCGCCCAGCGCACGCCGAATCCGTTCGATCTCGCGGTCCTGCGCAGCTTCCGCAT
GCCGGTGCAGCTCTGA
 Primer design