SecReT6
Protein ID: 563652570
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05100
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1090128..1090388 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDV5RZ62
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 86 a.a.     [Download]
>gi|563652570|ref|YP_008860631.1| type VI secretion protein IcmF [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MREGNESKRALIGVSGGAPRSISFSGPWAQFRLFGAGQLTGVQEGTFSVRFNVDGGAMVYRVHTDTEDNP
FTGGLFSQFRLPDTLY
 
Nucleotide Sequence: 261 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1090388-1090128 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGCGTGAAGGCAATGAAAGTAAGCGGGCGCTGATAGGCGTCAGTGGCGGCGCGCCGCGCAGCATCAGTT
TCAGCGGGCCGTGGGCACAGTTCAGGCTGTTCGGCGCCGGGCAACTTACCGGCGTTCAGGAGGGGACATT
CAGCGTGCGCTTTAACGTGGACGGCGGAGCGATGGTGTACCGGGTACATACCGATACGGAAGATAACCCC
TTCACCGGCGGGCTGTTCAGTCAGTTCCGGCTGCCGGATACCCTGTACTGA
 Primer design