SecReT6
Protein ID: 563652574
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05120
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1093693..1097154 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDV5S0M4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.50E-82, Aligned region: 484..797
ImcF-related_N [PF14331], Evalue: 1.70E-60, Aligned region: 185..431
DUF1215 [PF06744], Evalue: 2.00E-33, Aligned region: 893..1012
AAA_22 [PF13401], Evalue: 0.00057, Aligned region: 120..252
AAA_22 [PF13401], Evalue: 0.00057, Aligned region: 640..662
AAA_22 [PF13401], Evalue: 0.00057, Aligned region: 831..866
Protein Sequence: 1153 a.a.     [Download]
>gi|563652574|ref|YP_008860635.1| type VI secretion protein IcmF [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MPRFKVSAAWLLALAWILLLVWIWWKGPSWTLYEQRWLAPLANRWLATAAWGLIALAWLTVRVMKRLQLL
EKQQRQQRDEAQDPLSVELNTQQRYLDHWLLRLQRHLDSRRYLWQLPWYMVIGPAGSGKTTLLREGYPSD
IIYAPEALRGVEQRRYVIPHVGKQAVIFDADGLLFEQQDADILHRRLWTHMLDWLAQKRARQPLNGLILT
LDLPDLLTADKPRREHLLQILRGRLQDIRQHLHCQLPVYVVLTRLDLLHGFAALFQSLDRNDRDAILGVT
FTRHAHENDDWRTELNAFWQAWGERLNNALPERMLAPGSRSSLFSFVRQIQGGREPLIALLNGLLDGENM
DVMLRGVYLTSSLQRGQIDDIFMQSAARQFRLGSSPLTAWPLVDTLPYFTRNLFPQTLLAEPNLASESRV
WLMQSRRRLSVFSATGGIAALLLIIGWHHYYNNNWRSGITVLEQAKAFMSVPPPQGMDEYGNLQLPLLNP
VRDATLAYGDWGDRSRLADMGLYQGRRVGPYVEQTYLQLLEQRYLPALFNGLVKEMNAAPAESEEKLAVL
RVIRMLEDKSGRSDEVVKQYMAKRWSDKFHGQRDIQAQLMSHLDYALKHTDWHAERQAGDGDAISRWTPY
DSPVVAAQKELSKLPVYQRVYQSLKTRAMGVLPADLNLRDQVGATFDQVFTSGDDNKLIVPQFLTRYGLQ
SYFVKQRDALIELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYLSDYTATWRAGMDNLNVRNYESIAQ
LTGALEQIISGDQPLQRALTALRDNTQPAVLSEKLDDKALQEAMAEPDYQLLTRLGHEFAPENSTLAIQK
DKENTLQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGKL
ADQAWHVVMVEAVHYMEIDWRDNVVKPFNEQLANNYPFNPRSQSDASLDAFERFFKPNGVLDTFYQQNLR
LFMENDLSLEDGDNNVIIREDVREQLDTAQEIREAFFSRQNGLGAQFAVETVSLSGNKRRSVLNLDGQLV
DYSQGRNYTAHLVWPNNMREGNESKLTLIGVSGGAPRSISFSGPWAQFRLFGAGQLTGVQEGTFSVRFNV
DGGAMVYRVHTDTEDNPFTGGLFSQFRLPDTLY
 
Nucleotide Sequence: 3462 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1097154-1093693 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGCCCCGGTTTAAGGTTTCTGCCGCCTGGCTGCTGGCGCTGGCGTGGATTTTGCTGCTGGTATGGATCT
GGTGGAAAGGTCCGTCATGGACGCTCTACGAGCAGCGCTGGCTGGCCCCGCTGGCGAACCGCTGGCTGGC
CACCGCCGCCTGGGGGTTGATTGCGCTGGCGTGGCTGACCGTCCGGGTCATGAAGCGCCTGCAACTGCTG
GAAAAACAGCAGCGCCAGCAACGGGACGAGGCGCAGGATCCGCTCAGCGTGGAACTGAACACCCAGCAAC
GCTATCTCGATCACTGGTTACTGCGTCTGCAACGCCATCTCGACAGCCGCCGCTATCTGTGGCAGCTACC
GTGGTATATGGTCATTGGCCCGGCAGGAAGCGGTAAAACCACGCTGTTGCGCGAAGGGTATCCGTCCGAC
ATCATTTATGCCCCGGAGGCGCTGCGGGGCGTGGAGCAGCGCCGGTATGTTATCCCGCATGTGGGAAAAC
AGGCGGTGATTTTTGACGCCGACGGTCTCCTCTTTGAGCAACAGGATGCGGATATACTGCATCGCCGCCT
GTGGACCCATATGCTGGACTGGCTGGCGCAAAAACGCGCCCGGCAGCCGCTGAACGGTCTGATACTGACG
CTGGATCTGCCCGATCTGCTGACCGCCGACAAGCCACGCCGTGAGCACCTGTTGCAGATCCTGCGCGGAC
GTTTGCAGGATATACGCCAGCATCTTCACTGCCAGCTCCCCGTCTATGTGGTGCTGACCCGGCTGGATCT
ACTGCACGGTTTCGCCGCCCTGTTTCAGTCACTGGACCGCAACGATCGCGACGCCATTCTTGGCGTCACC
TTTACCCGTCATGCCCATGAAAATGACGACTGGCGTACAGAACTGAATGCCTTCTGGCAGGCATGGGGCG
AACGGTTGAATAACGCCCTGCCGGAGCGGATGTTAGCCCCCGGCTCCCGCAGTTCCCTGTTCAGCTTTGT
CCGCCAGATCCAGGGGGGCCGCGAGCCGCTGATCGCCCTGCTGAACGGGCTGCTGGACGGGGAAAATATG
GATGTGATGCTGCGCGGCGTGTACCTCACCTCCTCCCTGCAACGCGGCCAGATAGACGATATTTTTATGC
AGTCCGCCGCCCGTCAGTTCCGGCTGGGCAGCAGCCCGCTGACCGCCTGGCCGCTGGTGGACACGTTACC
GTATTTCACCCGTAATCTGTTTCCGCAGACCTTACTGGCTGAGCCTAACCTCGCCAGTGAAAGCCGCGTC
TGGCTGATGCAGTCCCGCCGCCGGTTGTCCGTGTTTTCCGCCACCGGCGGCATCGCCGCCCTGCTGCTGA
TTATCGGCTGGCATCACTATTACAATAACAACTGGCGTTCCGGCATCACCGTACTGGAGCAGGCCAAAGC
CTTTATGTCCGTGCCGCCACCGCAGGGTATGGACGAATACGGCAACCTGCAACTGCCGTTACTTAACCCG
GTGCGTGACGCCACGCTGGCCTACGGCGACTGGGGCGATCGCAGCCGCCTGGCCGATATGGGATTATATC
AGGGCAGGCGTGTCGGCCCATATGTGGAGCAGACCTACCTGCAACTGCTGGAGCAGCGTTACCTGCCCGC
CCTGTTTAACGGCCTGGTCAAAGAGATGAATGCCGCGCCTGCGGAGAGCGAGGAGAAGCTTGCGGTATTG
CGCGTTATCAGAATGCTGGAAGATAAAAGCGGACGCAGCGACGAGGTGGTGAAGCAGTATATGGCGAAAC
GCTGGAGTGATAAATTTCACGGCCAGCGCGATATTCAGGCACAGCTGATGTCTCATCTGGACTACGCGCT
GAAACACACCGACTGGCACGCGGAGCGTCAGGCAGGCGACGGCGACGCCATCAGCCGCTGGACGCCGTAT
GACAGTCCGGTCGTGGCGGCGCAGAAAGAGCTCAGCAAACTGCCCGTCTACCAGCGCGTTTACCAGAGTC
TGAAAACGCGGGCGATGGGCGTGCTGCCCGCTGACCTGAACCTGCGCGACCAGGTGGGCGCCACGTTTGA
TCAGGTCTTTACCTCCGGGGATGATAATAAGCTCATTGTTCCGCAGTTCCTCACCCGTTACGGTCTGCAA
AGTTATTTTGTCAAACAGCGCGACGCGCTGATCGAACTGACGGCGATGGATTCCTGGGTGCTGAACCTGA
CCCGCAGCGTGAAATACAGCGACGCCGACCGGGCAGAAATCCAGCGCCAGCTCACTGAACAGTATCTCAG
CGACTACACCGCCACCTGGCGAGCCGGAATGGACAACCTTAACGTGCGCAATTACGAATCCATTGCGCAA
CTGACCGGGGCGCTGGAGCAGATCATCAGCGGCGATCAGCCGCTCCAGCGGGCGCTGACGGCACTGCGCG
ACAACACGCAGCCTGCCGTTCTCTCTGAAAAACTGGATGACAAGGCGCTTCAGGAGGCGATGGCGGAGCC
GGATTACCAGTTGCTGACCCGCCTGGGGCATGAATTTGCCCCGGAAAACAGCACGCTGGCGATACAGAAA
GACAAAGAAAACACCCTCCAGGCGGTCTATCAGCAACTGACGGAGCTGCACCGTTACCTGCTGGCTATTC
AGAACGCGCCGGTGCCGGGAAAATCAGCGCTGAAAGCGGTGCAGCTACGGCTGGATCAGAACAGCAGCGA
TCCTATTTTCGCCACCCGCCAGATGGCGAAAACCCTGCCTGCCCCGCTCAACCGCTGGGTGGGCAAGCTG
GCGGATCAGGCCTGGCACGTGGTGATGGTGGAAGCGGTCCATTACATGGAGATTGACTGGCGTGACAACG
TGGTGAAACCGTTTAACGAACAGCTTGCCAACAACTATCCGTTTAACCCGCGCTCACAGTCAGATGCGTC
GCTGGATGCGTTTGAACGCTTCTTTAAACCGAATGGCGTACTGGATACCTTTTATCAGCAGAACCTGCGG
CTGTTTATGGAAAACGATCTGAGTCTGGAGGACGGGGATAACAACGTGATTATTCGTGAGGATGTCCGGG
AGCAACTGGATACCGCACAGGAAATCCGCGAGGCGTTTTTCAGCAGACAGAACGGCCTGGGCGCGCAGTT
TGCCGTGGAAACCGTGTCGCTTTCCGGCAACAAACGGCGCAGCGTGCTGAACCTGGACGGGCAGTTAGTG
GACTACAGCCAGGGCCGCAATTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCAATGAAA
GTAAGCTGACGCTGATAGGCGTCAGTGGCGGCGCGCCGCGCAGCATCAGTTTCAGCGGACCGTGGGCGCA
GTTCAGGCTGTTCGGCGCCGGGCAACTTACCGGCGTTCAGGAGGGGACATTCAGCGTGCGCTTTAACGTG
GACGGCGGAGCGATGGTGTACCGGGTACATACCGATACGGAAGATAACCCCTTCACCGGCGGGCTGTTCA
GTCAGTTCCGGCTGCCGGATACCCTGTACTGA
 Primer design