SecReT6
Protein ID: 564952558
SecReT6 ID878
T6SS typei4a
Gene symbol-
Locus tagU769_13430
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]2919711..2923526 [+]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDV5SWR9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.90E-34, Aligned region: 114..354
Protein Sequence: 1271 a.a.     [Download]
>gi|564952558|ref|YP_008885128.1| type VI secretion system protein ImpL [Pseudomonas aeruginosa MTB-1]
MSGATLFMLVLLLLLLALLLGALGWWWRTRGGTEIRSFYAAVRQMEREQGWQGRYEAPWLLMLGNETEGE
QLCATWRLLPVARPAWFGRWWSDGEGAILLVPESVFLPDEGLRRQSGAWLRLLRLFLRLRGRRALDGVVW
NIPLARLQDGEQAANLGLAARRRYVELTQRLGLSLPVYVVITGLEDLPGFQELLAALPEEARERALGWSS
PFAAEAAWQSRWCEQALEEITATLTESIVELGTLRGQVNNDLYCLPPRLESLRGSLQALLEPVFQGNARG
EAPRFRGLYLSGSEAAVAASDEALPAVDAPRRRSSFASQLWARRILAEEGLAQAVPRILQLRQRWQRGIG
LAALCLCLLWGGLMTWVWRDALRDAGELSQLLHGASERYQPLDDDTRRAAQVRQNVQAWWQLVAQAPRWR
FTSLAFPSSWFSSLDARIDSAYRRVSERLLVRPLRSLLEGEASDLRAIRSDGQPGLKEGDDPSQWKDYLA
AKDLVARATTLERHNRLFAQAIDNRKTPLDDLLQLSNDALGSSYNAGSLARLAYYNRTLFAERPADLAAL
DLGRVGATAADNFHDLMARWLNAYFLTDSLERTGNALTQELAQLGQERDATAAQLLGVGELINHLQQQVN
RINLIWGNGVGQDLVPGYQNLLKSAQQSSLLGDRVEELQNLTVQLQQQFRSEWIAPPEAAGDGLLVKQGA
TLKLADDLLGLKRAIDDLKTKDFVSVALAGKTLAEHSLLSIDDIGVTQALSFFNDFSGYYESTLPSLNPR
YRYSVLHAAASATTEAMWQSLGPRSRSLTSRNASRFDVQVKQVQALQAALLELQDMQAGARLLASLNALA
VADIGQALRDIDEQAVLREPVDFSRWSGAPNFGLQAFRAQDSAELKQSLTSQFNAMAAVAERHAPALEWL
QAQQSSLATADYNAFVRFSALNAELQKFKADNPASTAAQLAKLVGNDFNQMDIGSCADILNGVLLPSSRS
DLATRLVDLRQGALGRCQSLQQQQAAQAWKDLADYFNQYLAGRFPFAYSLEAADAEPGRVRHLLKLMETR
LPQVREGLAQVRSPDLPAAEDFVRRLEQAQGWLGPLFERDKSGLLGVALDIDWRSDRSLERGADQVIAWS
LYSGDQESRFPGAQDKGLTWNVGDPLKIMLRWAKNGSQRPADDPRQASLAVADLEAGWSYQGSWALLRMM
RAHFSRQRPPNVDYTEFPLVLQLPVYAPYSPENEARMFLRLSLMSLGGKTPLSIQPLPVRAPQSPFATLL
PATVASTGGIP
 
Nucleotide Sequence: 3816 bp     [Download]
>gi|564949884|ref|NC_023019.1|:2919711-2923526 Pseudomonas aeruginosa MTB-1, complete genome
ATGAGCGGCGCGACGCTGTTCATGCTGGTTCTCCTCCTGCTGCTGCTGGCGCTGCTGCTGGGGGCGCTGG
GCTGGTGGTGGCGGACCCGGGGCGGTACGGAGATCCGCAGCTTCTACGCGGCGGTCCGGCAGATGGAGCG
CGAGCAGGGCTGGCAGGGCCGCTACGAAGCGCCGTGGCTGCTGATGCTAGGCAACGAGACCGAGGGCGAG
CAGTTGTGCGCCACCTGGCGCCTGCTGCCGGTGGCGCGTCCGGCCTGGTTCGGCCGCTGGTGGTCGGACG
GCGAGGGGGCGATCCTGCTGGTGCCCGAGTCGGTGTTCCTGCCCGACGAGGGCCTGCGCCGGCAAAGCGG
CGCCTGGCTGCGCCTGTTGCGTCTGTTCCTGCGCCTGCGCGGCAGGCGCGCGCTGGACGGAGTGGTCTGG
AACATTCCGCTGGCGCGGCTGCAGGATGGCGAGCAGGCGGCCAACCTCGGCCTCGCCGCCCGTCGTCGCT
ACGTGGAACTGACCCAGCGCCTTGGCCTGAGCCTGCCGGTTTACGTGGTGATCACTGGCCTGGAAGACCT
GCCGGGTTTCCAGGAGCTTCTCGCGGCGCTGCCCGAGGAGGCGCGCGAGCGCGCCCTCGGCTGGTCCTCG
CCGTTCGCCGCCGAAGCGGCCTGGCAGTCGCGCTGGTGCGAGCAGGCGCTGGAGGAAATCACCGCCACCC
TGACCGAGTCGATCGTCGAACTCGGTACCTTGCGCGGCCAGGTGAACAACGACCTGTATTGCCTGCCGCC
ACGCCTGGAAAGCCTCCGCGGTTCGTTGCAGGCGCTGCTCGAACCGGTCTTCCAGGGCAACGCCAGGGGT
GAGGCGCCGCGCTTTCGCGGTCTCTACCTGAGCGGCAGCGAGGCGGCGGTGGCGGCAAGCGACGAAGCCC
TGCCGGCGGTCGACGCGCCGCGTCGGCGCAGCAGCTTCGCCAGCCAACTGTGGGCACGGCGGATCCTTGC
CGAGGAAGGCCTGGCCCAGGCGGTGCCGCGCATCCTCCAACTGCGCCAGCGCTGGCAGCGCGGTATCGGC
CTCGCTGCGCTGTGCTTGTGCCTGCTCTGGGGCGGCCTGATGACCTGGGTCTGGCGTGACGCGCTGCGCG
ACGCCGGCGAACTGTCGCAACTGCTGCATGGCGCCAGTGAGCGCTACCAGCCGCTCGACGACGACACTCG
GCGCGCCGCCCAGGTCCGGCAGAACGTCCAGGCCTGGTGGCAACTGGTGGCACAGGCGCCGCGCTGGCGC
TTCACCTCGCTGGCGTTCCCCAGTTCCTGGTTTTCCTCCCTGGACGCACGCATCGACAGCGCGTATCGCC
GCGTTTCCGAGCGCCTGCTGGTACGCCCGCTGCGCAGCCTGCTGGAAGGCGAGGCGAGCGACCTGCGGGC
GATCCGCAGCGACGGCCAGCCCGGCCTGAAGGAGGGCGACGACCCCAGCCAGTGGAAGGACTACCTGGCG
GCGAAGGACCTGGTCGCCCGCGCCACTACCCTGGAGCGCCACAATCGCCTGTTCGCCCAGGCCATCGACA
ACCGCAAGACGCCGCTCGACGATCTCCTGCAACTGAGCAACGATGCCTTGGGCAGCAGCTACAACGCCGG
CAGCCTGGCGCGCCTGGCCTATTACAACCGCACGCTGTTCGCCGAGCGTCCGGCCGATCTCGCCGCCCTC
GACCTGGGCCGGGTCGGGGCCACGGCGGCGGATAACTTCCATGACCTGATGGCCCGCTGGCTGAACGCCT
ACTTTCTCACCGACAGCCTGGAACGCACCGGCAATGCCCTGACCCAGGAACTCGCGCAGCTCGGCCAGGA
ACGAGATGCCACGGCGGCCCAGTTGCTGGGGGTCGGCGAATTGATCAACCACCTGCAGCAGCAGGTCAAC
CGCATCAACCTGATCTGGGGCAATGGCGTCGGCCAGGATCTCGTCCCTGGCTACCAGAACCTGCTCAAGA
GCGCCCAGCAAAGCAGCCTGCTGGGAGACCGCGTGGAGGAACTGCAGAACCTCACGGTGCAGTTGCAGCA
GCAGTTCCGCAGCGAATGGATCGCGCCTCCGGAGGCTGCCGGCGACGGCCTGCTGGTGAAGCAGGGGGCG
ACGCTCAAGCTGGCCGATGACCTGCTCGGCCTGAAACGCGCCATCGATGACCTGAAGACCAAGGACTTCG
TCTCCGTGGCCCTGGCCGGCAAGACGCTGGCGGAGCACTCCCTGCTGAGCATCGACGACATCGGCGTGAC
CCAGGCGTTGAGCTTCTTCAACGACTTCAGCGGCTACTACGAGAGCACCCTGCCGTCGCTCAACCCGCGC
TATCGCTACTCGGTCCTGCACGCCGCCGCCAGCGCGACGACCGAGGCCATGTGGCAAAGCCTCGGGCCGC
GCAGTCGCAGCCTGACCAGCCGCAATGCCTCGCGCTTCGACGTGCAGGTCAAGCAGGTCCAGGCATTGCA
GGCGGCGCTGCTGGAGTTGCAGGACATGCAGGCCGGCGCGCGCCTGCTGGCCAGCCTCAACGCGCTGGCC
GTGGCCGATATCGGCCAGGCCCTGCGCGACATCGACGAGCAGGCGGTGCTGCGCGAGCCGGTCGATTTCA
GTCGCTGGTCGGGCGCGCCGAATTTCGGCCTGCAGGCGTTCCGCGCCCAGGACAGCGCCGAGCTGAAGCA
GAGCCTGACCAGCCAGTTCAATGCCATGGCCGCGGTCGCCGAGCGCCACGCCCCGGCGCTGGAGTGGCTG
CAGGCGCAGCAGTCCAGCCTGGCCACCGCCGACTACAACGCGTTCGTGCGCTTCAGCGCGCTCAACGCCG
AACTGCAGAAATTCAAGGCCGACAACCCGGCGAGCACCGCGGCGCAGCTGGCGAAGCTGGTGGGTAACGA
TTTCAACCAGATGGACATCGGCAGTTGCGCCGACATTCTCAACGGCGTGCTCCTGCCGTCCAGTCGCAGC
GACCTGGCGACGCGCCTGGTGGACCTGCGCCAGGGCGCGCTCGGGCGCTGCCAGTCGTTGCAACAGCAGC
AGGCGGCGCAGGCCTGGAAGGACCTCGCCGACTACTTCAACCAGTACCTCGCCGGACGCTTCCCCTTCGC
CTACAGCCTGGAAGCGGCCGATGCCGAGCCGGGGCGGGTGCGGCACCTGCTGAAGCTGATGGAGACGCGC
TTGCCGCAGGTGCGCGAAGGGCTGGCCCAGGTTCGCTCGCCGGACCTGCCGGCCGCCGAGGACTTCGTCC
GCCGCCTGGAGCAGGCGCAGGGCTGGCTCGGCCCGCTGTTCGAGCGCGACAAGTCGGGCCTGCTCGGCGT
CGCCCTGGACATCGACTGGCGCAGCGACCGCAGCCTGGAACGCGGCGCCGACCAGGTGATCGCCTGGAGC
CTGTACTCGGGCGACCAGGAAAGCCGGTTCCCCGGCGCGCAGGACAAGGGCCTGACCTGGAACGTCGGCG
ATCCGCTGAAGATCATGCTGCGCTGGGCGAAGAACGGCTCGCAGCGCCCGGCAGACGACCCGCGCCAGGC
CAGCCTGGCGGTGGCCGACCTCGAGGCCGGCTGGAGCTACCAGGGCTCCTGGGCGCTGCTGCGCATGATG
CGTGCGCACTTCTCCCGGCAGCGCCCGCCGAACGTCGACTACACGGAGTTTCCGCTGGTCCTGCAACTGC
CGGTGTATGCACCCTACAGCCCGGAAAACGAGGCGCGGATGTTCCTCCGCCTGTCGTTGATGAGCCTGGG
CGGCAAGACCCCGCTGTCCATCCAGCCGCTGCCGGTGCGCGCGCCGCAATCGCCGTTCGCGACGCTGTTG
CCGGCCACCGTCGCCAGCACCGGAGGTATCCCATGA
 Primer design