SecReT6
Protein ID: 564953353
SecReT6 ID879
T6SS typei1
Gene symbol-
Locus tagU769_17375
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]3760630..3761619 [-]
Productserine/threonine protein kinase
NoteStk1
UniProt IDV5SYZ7
KEGG IDpaem:U769_17375
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 2.70E-41, Aligned region: 51..305
Pkinase_Tyr [PF07714], Evalue: 4.20E-26, Aligned region: 53..306
APH [PF01636], Evalue: 4.20E-05, Aligned region: 97..176
APH [PF01636], Evalue: 4.20E-05, Aligned region: 172..203
APH [PF01636], Evalue: 4.20E-05, Aligned region: 229..302
RIO1 [PF01163], Evalue: 0.0046, Aligned region: 128..202
Protein Sequence: 329 a.a.     [Download]
>gi|564953353|ref|YP_008885923.1| serine/threonine protein kinase [Pseudomonas aeruginosa MTB-1]
MNEPLSSLELLPEEEGGANLTYFAFAAPAASAPDLPAVLPGPLPDVLSGRYRLERMLGAGGMGTVYRARD
LLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRLFTFDVDTACQRAYIVMELMP
GLPLDRLLCERPEGLPWSELSAIARPLLDALAYVHEQGVLHGDLKPSNVMLGEEGVRLFDFGLGQAQAGI
LDGLPQLSRGRIDAWTPGYAAPELLEGAPLSPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQL
RAPGHLPRRCWPALRTALNLDPERRCIGVRELQEALGARRSWLAGVLAR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c3761619-3760630 Pseudomonas aeruginosa MTB-1, complete genome
ATGAACGAACCGCTGTCGTCGCTGGAGCTGCTGCCGGAGGAGGAGGGCGGCGCGAACCTGACCTATTTCG
CCTTCGCCGCCCCGGCCGCCTCGGCGCCGGACCTGCCGGCCGTGTTGCCCGGTCCGCTGCCGGACGTTCT
TTCCGGGCGCTACCGTCTGGAGCGGATGCTCGGCGCCGGCGGCATGGGCACGGTATACCGTGCCCGGGAC
CTGCTCCATGAGCAGTTCGGCGACCCGGCGCCCCTGGTAGCGTTGAAGCTGCTCAACGAATCGGTCGCCG
AGTCACCCGACGCCAGCGCCTTGCTCTATAGCGAGTTCGCCCTGACCCGGCGCTTGCGCCATCCGAACGT
CGTGCGTCTGTTCACCTTCGACGTCGACACCGCCTGCCAGCGCGCCTACATCGTCATGGAACTCATGCCT
GGCCTGCCGCTCGACCGCCTGCTCTGCGAGCGTCCCGAAGGCCTGCCCTGGTCCGAGTTGAGCGCGATCG
CCCGGCCGTTGCTGGACGCCCTGGCCTACGTCCACGAACAAGGAGTACTGCATGGCGACCTGAAGCCGAG
CAACGTGATGCTCGGCGAAGAGGGCGTGCGGCTCTTCGACTTCGGCCTCGGCCAGGCGCAGGCAGGCATC
CTGGATGGCCTGCCGCAGCTCAGCCGGGGCCGCATCGACGCCTGGACCCCGGGCTACGCCGCTCCCGAAC
TGCTCGAGGGCGCGCCATTGTCGCCGGCGGCCGACCTGTATGCGCTGGCCTGCGTCCTCTACGAACTGGC
CGATGGTCGCCATCCGTTCCGCCGCCTGCCCTCGAACCAGGCCCGGGAGCAGGGGCTGGAGCGCCAGCTG
CGCGCGCCCGGACACCTGCCTCGGCGCTGCTGGCCGGCGCTGCGTACCGCCCTGAATCTCGACCCCGAAC
GGCGCTGCATCGGCGTCCGCGAATTGCAGGAAGCGCTGGGCGCGCGGCGTTCCTGGCTGGCCGGCGTTCT
TGCCCGTTGA
 Primer design