SecReT6
Protein ID: 564954406
SecReT6 ID880
T6SS typei1
Gene symbol-
Locus tagU769_22660
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]4856552..4860289 [-]
Producttype VI secretion protein VasK
NoteTssM
UniProt IDV5T307
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.80E-81, Aligned region: 540..852
ImcF-related_N [PF14331], Evalue: 1.30E-70, Aligned region: 234..487
DUF1215 [PF06744], Evalue: 2.40E-32, Aligned region: 961..1083
Protein Sequence: 1245 a.a.     [Download]
>gi|564954406|ref|YP_008886976.1| type VI secretion protein VasK [Pseudomonas aeruginosa MTB-1]
MWKIWSNLQRFGRPVLRWFKPGVPLMLLVLMLLALGAIWWLGPQWTWGERQPLGNLTARVLATVVLLVIP
LLAWALRLRQRARQLEAERKHDDAVQVDACLRYVEAQERDLDRSLALLQSHLKGRHALYQMPWYLVLGQE
NSGKTSFVNRSNQSFSLTGEVKAGSRRLQEDPDKIYTIDWWIGAQAVLIDPPGEIISQPRIGADAKDGGM
QDAAAVDKGVSARRLPAGLPEDLHSRLWDSFVAWLGRNRSRRPLNGVVLMVSLVTLLNQKPSDRKALAAL
LRARLTELSRELGTRPPLYVVLSKFDLLEGFETLFARLPKSAREDIFGFSFTLDSVRDYDAWLEELGVRY
DAFLGRLNEQVFDAMADVTETSQRESLYSLVRQLSGLRPVLLGFLADVMGSDRFATPALPRGVFFSSVYQ
QGVLNNAFVASAARTYDLREPVNDVHPSGRAMVYFAQQLFQRIIYPESGLAGDNPRVLAQKKHALVLRFG
IASLGSMLLIGGWYHYYAVNRDKALSVLDRSRDFSASAIDGQLDPTGRNLLQPLNQISNAVAVYGDYRDA
WPLVADMGLYQGRAIGPKVDEAYLALLSQRFLPALASGVMEELDGKDTDSDAQLAALRVYRMIEDRPNRR
PPVVEGWMAAQWQAAFPGEDRVQRTLMRHLEYAMKYADTRLPQYQARVAVVQRQLRQIPLPERVYMTMRR
ESGASLRSPLDLRNEIGPAFDIVYQPEFETAKGEEGSRLPANGRIDALLTARGYSSYFAPHSEDLTELAM
IDQWALGERSKIDYSEADKAALAERIRAIYSRDYVDTWQRNLNQLEIRDFQDIAQAVSILGSVTSPAAPL
RRLVETVRDNSELGVKAVPAKSGTETVADKAASLVDKSVKTSDDAQTAPPIMDIARAFAPMSQLLDAKGE
RASYLDETMQAIGSVQDRVRIVHDSPDRGKAALGLVLERFSLKGPDPIANLQRIAAGLPEPMNRQVGKLA
DESSRVILVEALRELERRWDADVYRFYRERLANRYPFNPASREEASLEDFTAFFGPQGRLQQFRNKYLNL
FLEENLEALYSERLGGYLVRADVLTQLESADRIRDAFFNSRGLLGVQFYVEPLGLAPNKRSSSLSVEGQL
VTYNHGPTTSTALIWPNTLAPSNESRMTLVNAGGSSSGLVYRGPWSLYRLLSQARLNGATSTSVDISFSA
PDGGMRYRVSTEKANNPFTQPLFKGFVLPHTLLQDGLRARADSDGNAGRRLREAG
 
Nucleotide Sequence: 3738 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c4860289-4856552 Pseudomonas aeruginosa MTB-1, complete genome
ATGTGGAAAATCTGGTCCAACCTCCAACGATTCGGCCGACCCGTCCTGCGCTGGTTCAAGCCTGGCGTGC
CGCTGATGCTGTTGGTGCTCATGCTTCTGGCACTGGGCGCCATCTGGTGGCTCGGGCCCCAATGGACCTG
GGGCGAACGCCAGCCTCTTGGAAACCTGACCGCGCGCGTCCTTGCTACGGTCGTGCTGCTGGTCATCCCG
CTGCTGGCATGGGCTCTGCGCCTGCGCCAACGCGCGCGACAGCTGGAGGCCGAACGCAAGCACGATGATG
CAGTGCAGGTAGACGCCTGCCTGCGGTACGTCGAGGCGCAGGAACGCGATCTCGATCGGAGCCTGGCGCT
GCTCCAGTCCCACCTCAAGGGACGTCACGCCCTGTACCAGATGCCCTGGTACCTGGTGCTGGGGCAGGAG
AACTCGGGCAAGACCAGCTTCGTTAACCGTTCCAATCAGAGCTTCTCGCTGACCGGAGAAGTGAAAGCTG
GCAGCCGGCGCCTGCAGGAGGACCCGGACAAGATCTACACCATCGACTGGTGGATAGGCGCCCAGGCAGT
GCTCATCGATCCACCCGGGGAAATCATCAGCCAGCCCCGGATTGGCGCCGACGCGAAAGATGGCGGCATG
CAGGATGCTGCGGCCGTCGACAAAGGTGTCTCGGCGCGCCGGCTCCCGGCAGGATTGCCGGAAGATCTCC
ATTCGCGTCTGTGGGACAGCTTTGTCGCCTGGCTTGGACGCAACCGCAGCCGTCGGCCGCTCAACGGCGT
GGTGTTGATGGTCAGCCTAGTCACCTTGCTGAATCAGAAGCCCAGTGACCGTAAAGCTCTGGCCGCGCTA
CTGCGCGCCCGGCTGACCGAACTCAGCCGCGAGCTCGGCACACGCCCGCCCTTGTATGTCGTGCTCAGTA
AGTTCGACCTGCTCGAAGGCTTCGAGACCCTGTTTGCCCGTCTGCCAAAATCCGCGCGGGAGGACATTTT
CGGCTTTAGTTTCACCTTGGATTCCGTGCGGGACTACGATGCCTGGCTGGAGGAGCTTGGCGTGCGCTAC
GACGCTTTCCTGGGCCGGCTGAACGAGCAGGTCTTCGACGCCATGGCGGACGTTACTGAAACGTCGCAAC
GCGAATCGCTGTATTCCCTGGTGCGGCAGCTGTCAGGCCTGCGACCGGTGCTGTTGGGTTTCCTGGCGGA
TGTGATGGGCAGCGATCGCTTCGCCACCCCAGCTCTACCGCGCGGCGTGTTCTTCTCCTCGGTGTACCAG
CAGGGCGTGCTCAACAACGCCTTCGTGGCATCGGCCGCAAGGACCTACGACCTGCGCGAGCCGGTCAATG
ACGTACACCCCAGCGGGCGGGCGATGGTCTACTTCGCCCAGCAACTGTTTCAACGGATCATCTACCCCGA
GTCCGGCCTTGCCGGCGACAATCCGCGGGTCCTTGCGCAGAAGAAGCATGCCCTGGTCCTGCGCTTCGGC
ATTGCGTCGCTGGGCAGCATGCTGCTCATCGGCGGCTGGTACCACTACTACGCGGTCAACCGCGACAAGG
CCCTGAGCGTACTGGATCGCAGCCGAGATTTCAGTGCCAGCGCCATCGACGGACAGTTGGATCCAACCGG
CCGCAACCTGCTGCAGCCACTGAACCAGATCAGCAATGCGGTCGCCGTCTACGGGGACTACCGGGATGCC
TGGCCGCTGGTCGCCGACATGGGGTTGTACCAGGGACGGGCGATAGGCCCCAAGGTTGACGAGGCCTACC
TGGCGCTGCTGTCGCAACGCTTCCTGCCGGCGCTGGCCAGCGGAGTCATGGAAGAACTGGACGGTAAGGA
CACCGACAGTGACGCCCAACTGGCCGCTCTGCGCGTGTACCGGATGATCGAAGACCGGCCCAACCGCCGT
CCGCCGGTCGTCGAAGGCTGGATGGCCGCGCAGTGGCAGGCAGCCTTCCCCGGCGAGGATCGCGTCCAGC
GCACCCTCATGCGCCACCTCGAATATGCAATGAAGTATGCCGACACGCGCCTGCCGCAGTACCAGGCCCG
GGTCGCGGTGGTTCAGCGGCAACTGCGACAGATCCCCTTGCCGGAGCGGGTGTACATGACCATGCGCCGA
GAGTCGGGAGCGTCCCTGCGTTCGCCGCTGGATCTACGCAACGAAATTGGCCCGGCCTTTGACATCGTCT
ACCAGCCCGAATTCGAAACAGCGAAGGGGGAGGAGGGGAGTCGCCTGCCCGCCAACGGCCGCATCGATGC
CCTGCTGACCGCCAGGGGTTACAGCAGCTACTTCGCTCCGCACAGCGAGGATCTCACCGAACTGGCGATG
ATCGACCAGTGGGCCCTGGGCGAGCGCAGCAAGATCGACTATTCGGAAGCCGACAAGGCAGCCTTGGCCG
AGCGCATCCGTGCGATCTACAGCCGTGACTACGTGGACACCTGGCAGCGCAACCTCAACCAGCTCGAGAT
ACGGGACTTCCAGGACATCGCACAGGCGGTCAGCATCCTCGGAAGCGTCACCAGTCCGGCCGCGCCGCTG
CGCCGCCTGGTCGAAACGGTGCGCGACAACAGTGAGCTTGGCGTCAAGGCGGTTCCTGCCAAGAGCGGTA
CGGAAACAGTGGCCGACAAGGCTGCTTCGTTGGTCGACAAGTCGGTCAAGACCAGCGACGACGCGCAGAC
GGCTCCGCCGATCATGGACATCGCGCGCGCCTTCGCGCCCATGAGCCAACTCCTGGACGCCAAGGGCGAG
CGTGCGTCTTATCTGGACGAAACCATGCAGGCCATCGGCAGCGTGCAGGACAGGGTGCGCATCGTCCACG
ACAGTCCAGACCGAGGCAAGGCCGCACTTGGCTTGGTGCTGGAACGCTTTTCTCTGAAAGGCCCCGACCC
CATTGCCAACCTGCAGCGCATCGCCGCTGGACTGCCGGAGCCGATGAACCGGCAAGTGGGCAAGCTGGCC
GACGAATCCTCACGGGTGATCCTGGTGGAGGCGCTACGCGAGTTGGAGCGCCGCTGGGATGCCGATGTCT
ATCGCTTCTACCGCGAGCGCCTGGCCAATCGCTATCCGTTCAACCCGGCCAGCCGAGAGGAAGCTTCCCT
AGAAGATTTCACCGCGTTCTTCGGCCCCCAGGGTCGGTTGCAGCAGTTCCGCAACAAGTACCTGAACCTC
TTCCTCGAAGAAAACCTGGAAGCCCTGTACTCCGAGCGCCTTGGTGGCTACCTGGTGCGGGCCGACGTAC
TGACCCAGTTGGAGTCGGCCGACCGCATCCGCGATGCATTCTTCAACAGTCGTGGCCTGCTGGGCGTGCA
GTTCTACGTCGAGCCCCTGGGACTAGCGCCTAACAAGCGCAGCAGCTCGCTCAGCGTCGAAGGGCAATTG
GTCACCTACAACCACGGCCCAACCACCAGCACCGCGCTCATCTGGCCGAACACCCTGGCACCTAGCAACG
AAAGCCGCATGACCCTCGTCAACGCCGGCGGCAGCAGTAGCGGCCTGGTCTATCGCGGCCCCTGGTCCCT
CTACCGCCTGTTGAGCCAGGCGCGCCTGAATGGCGCAACCAGCACCAGTGTGGATATCAGTTTCTCCGCG
CCGGACGGTGGCATGCGCTACCGCGTCAGCACGGAGAAGGCTAACAACCCGTTCACGCAGCCGCTGTTCA
AGGGCTTCGTGCTGCCACACACACTGCTGCAGGATGGCCTGCGGGCACGCGCTGATTCTGATGGCAACGC
CGGAAGGCGCCTGCGCGAGGCTGGATAA
 Primer design