SecReT6
Protein ID: 565643504
SecReT6 ID883
T6SS typei3
Gene symbol-
Locus tagP262_00048
StrainCronobacter sakazakii CMCC 45402
Repliconchromosome [GenBank: NC_023032] [Browse all T6SS(s) in this replicon]
Location [Strand]31032..34649 [+]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDV5TUM5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.20E-102, Aligned region: 207..484
ImcF-related_N [PF14331], Evalue: 8.20E-102, Aligned region: 764..816
IcmF-related [PF06761], Evalue: 2.90E-88, Aligned region: 533..836
DUF1215 [PF06744], Evalue: 6.40E-32, Aligned region: 946..1071
AAA_16 [PF13191], Evalue: 0.00064, Aligned region: 142..275
AAA_16 [PF13191], Evalue: 0.00064, Aligned region: 819..866
Protein Sequence: 1205 a.a.     [Download]
>gi|565643504|ref|YP_008894800.1| type VI secretion system protein ImpL [Cronobacter sakazakii CMCC 45402]
MLNILLSIVTNRILWGFMGVTALSAVVWMIGPLLSIVDSRPLESETNRIISIALIYLIWVHSHIVPRLYN
AWLNRKLMDKLNEGKPAEKGGSDVKRLGNDDKVLADRFDEAAQILKKAHFNAPGQRGQWTQRFSTQYLYQ
LPWYVIIGAPGSGKTTALVNSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQA
QDAGEWLSFVDLLRKYRRRQPINGVIITISVSDLLTQSPEATQQQAVNLRQRLAELHEQLGIRFPVYVLV
TKADLLKGFRSYFGRFDKAQRDQIWGFTFPWDRSKQADFDLLAAFTQEFALLQQRLDAGLPDTLLAESDP
KARAECYLFPQEFAALRPLLADYLSTVFARSNFETEFSPRGIYLASGTQEGLPFDRVMGELNRALSLPSG
GKEGDNWDSVSKEAPIPGGKGQSFFIKNLLQNVIFQEAGIAGQNRWWELRNRAVLWSGYAALIALLLILG
GLWLTSYGNNKDYLAEVNDKVPGVERQSKALQTTAGRDLFSMLPFFNSLVDLPKSKEFDLNSPPVTYRMG
LYRGDDVNDASQALYQKALQEMLMPAVAQLITGWVRNDNGSDVEYSYEALKAYQMLYQPKHYDGKFLHSW
VMLNLERNLPQNVTQAQLNQLEWHLTQLLEPQIQTSPYAKDESLISRQQAMINQKPLSLRVYGRLKRLLE
RDENLKPVSLATLGGPQSELVFSRKSGKPVSDGVPGLYTPKGYWESFNGQIDNVTASLHDDDTWVLGLTT
AQEDKTQTDNAVRQLYMRDFISQWDSYLADIQLNNSADLNQRINTARVLSSSNSPLRRLVMNLSQVLTLS
RAEPQAGEAQAKDQGNRATRTLEALFSDRESGATTAAAPQTPEQVVTDHYAPIIELAQPLEKGGKAIVFD
DFIKQIDELYRYLTAVQDAANSGMPPPGGEAISRLQASAGRLPGGLQNMFSRMAVGASSDTQQRELENVR
KRISVEVGSFCRQAIAGRYPLVRSASSEVTPDDLARMFAPGTGLMDSFFRDNLTNKVDTTQQRWRFTPGI
DGKTLPGSEGVLRPFQQAQYIRDAFFANGATTPSYRVTVRTVRMDNDILTLSLDVDGQLLRYSHGPQAVQ
LMSWPGSGGTNQVRMQLGLANGTTSTLVTNGAWALNRFFDRARIAPGAGSLSRQATFSVDGHSVTLEFTP
NSIRNPFQLPGFACP
 
Nucleotide Sequence: 3618 bp     [Download]
>gi|565643472|ref|NC_023032.1|:31032-34649 Cronobacter sakazakii CMCC 45402, complete genome
ATGCTGAATATTCTCCTTTCAATAGTGACCAACCGCATCTTGTGGGGGTTCATGGGCGTTACCGCGCTGT
CGGCGGTCGTCTGGATGATCGGGCCATTGCTGTCCATCGTCGACAGCCGCCCGCTGGAGTCGGAAACCAA
CCGTATCATCAGCATTGCGCTTATCTACCTGATTTGGGTGCATAGCCACATCGTGCCGCGGCTCTACAAC
GCCTGGCTGAACCGCAAGCTGATGGACAAACTTAACGAGGGCAAGCCTGCGGAAAAGGGCGGGAGCGACG
TTAAGCGCCTCGGCAATGACGATAAAGTGCTGGCGGACCGCTTTGACGAAGCCGCGCAGATCCTTAAAAA
AGCGCACTTCAACGCGCCGGGCCAGCGCGGCCAGTGGACGCAGCGTTTCAGCACGCAGTATCTCTATCAG
CTTCCGTGGTATGTGATTATCGGCGCGCCGGGGTCCGGTAAAACGACGGCGCTGGTCAACTCCGGCCTGC
AATTCCCGCTCGCCGATCGCTTTGGCAAAACGGCGCTGCGCGGCATTGGCGGCACCCGCAACTGCGACTG
GTGGTTCACCAACGAAGCGGTGCTGCTCGATACCGCAGGCCGTTACACCACGCAGGAGAGCGAACAGGCG
CAGGACGCCGGTGAATGGTTAAGCTTTGTCGATCTGCTGCGTAAATACCGCCGCCGCCAGCCGATTAACG
GCGTGATCATCACCATCAGCGTTTCTGATCTGCTGACCCAGTCGCCGGAGGCGACGCAACAGCAGGCCGT
CAACCTGCGCCAGCGCCTGGCGGAGCTGCATGAGCAACTCGGTATCCGCTTCCCGGTCTATGTGCTGGTG
ACTAAAGCGGACCTGCTGAAAGGCTTTCGTTCTTACTTTGGTCGCTTTGATAAAGCGCAGCGCGACCAGA
TCTGGGGCTTCACCTTCCCGTGGGATCGCTCAAAACAGGCCGACTTCGACCTGTTAGCGGCATTCACCCA
GGAGTTCGCGCTGCTCCAGCAGCGTCTCGACGCGGGCCTGCCGGATACGCTGCTTGCCGAAAGCGACCCG
AAAGCGCGCGCCGAGTGTTATCTGTTCCCGCAGGAGTTCGCGGCGCTGCGTCCGCTGCTCGCGGATTACC
TCAGCACCGTTTTTGCCCGCTCTAACTTTGAAACCGAATTCTCGCCGCGCGGGATTTATCTCGCGAGCGG
GACGCAGGAAGGGCTGCCGTTTGACCGTGTCATGGGTGAACTCAACCGCGCGCTGTCGCTGCCGTCCGGC
GGCAAAGAGGGCGACAACTGGGATTCGGTGAGCAAAGAAGCGCCGATCCCCGGCGGTAAAGGACAGAGCT
TCTTTATTAAGAACCTGCTCCAGAACGTGATTTTCCAGGAAGCGGGCATCGCCGGACAGAATCGCTGGTG
GGAGCTGCGCAACCGCGCGGTGCTGTGGTCTGGCTACGCGGCGCTGATAGCGCTGTTACTGATCCTGGGC
GGCCTGTGGCTCACCAGCTATGGCAACAACAAAGACTATCTGGCGGAAGTGAACGATAAAGTGCCGGGCG
TCGAACGCCAGAGTAAAGCGCTGCAAACCACCGCCGGGCGCGATCTCTTCAGCATGCTGCCGTTCTTTAA
CAGCCTGGTGGATCTGCCAAAGAGTAAAGAATTTGACCTGAACTCGCCGCCGGTGACGTACCGCATGGGG
CTTTATCGCGGCGATGACGTTAACGACGCTTCGCAGGCGCTCTACCAGAAAGCGCTGCAGGAGATGCTGA
TGCCTGCCGTGGCGCAGCTCATCACCGGCTGGGTGCGTAACGACAACGGCAGCGACGTGGAATACAGCTA
CGAAGCGCTGAAGGCGTACCAGATGCTCTACCAGCCGAAGCACTACGACGGCAAATTCCTGCACTCCTGG
GTAATGCTCAACCTTGAGCGCAACCTGCCGCAGAACGTCACCCAGGCGCAGCTTAACCAGCTCGAATGGC
ATCTGACGCAACTGCTGGAGCCGCAGATCCAGACCTCGCCATACGCTAAAGATGAGTCGCTGATTAGCCG
CCAGCAGGCGATGATCAACCAGAAACCGCTGTCGCTGCGCGTTTATGGCCGCCTCAAACGCTTGCTGGAG
CGCGATGAAAACTTAAAGCCGGTATCGCTCGCCACCCTCGGCGGCCCGCAGAGCGAGCTGGTCTTTTCGC
GTAAAAGCGGCAAGCCGGTGAGCGACGGCGTGCCGGGGCTTTACACCCCGAAAGGCTACTGGGAAAGCTT
CAACGGCCAGATTGATAACGTCACCGCCTCGCTGCATGACGATGACACCTGGGTGCTCGGGCTGACCACC
GCGCAGGAAGACAAAACGCAGACCGACAACGCGGTGCGCCAGCTCTATATGCGCGATTTTATCAGCCAGT
GGGACAGCTACCTGGCGGATATTCAGCTTAACAACAGCGCCGACCTGAACCAGCGCATCAACACGGCCCG
CGTGCTTTCCAGCAGCAACTCGCCGCTGCGCCGCCTGGTGATGAACTTAAGCCAGGTGCTGACGCTCTCC
CGCGCCGAGCCGCAGGCGGGCGAAGCGCAGGCGAAAGATCAGGGCAACCGCGCAACCCGCACGCTGGAAG
CGCTGTTCAGCGACCGTGAAAGCGGGGCGACCACCGCCGCCGCGCCGCAGACGCCGGAACAAGTGGTGAC
CGATCACTACGCGCCGATTATCGAACTGGCGCAGCCGCTGGAGAAAGGCGGCAAAGCCATCGTGTTTGAT
GACTTTATTAAGCAGATCGATGAGCTTTACCGTTATCTGACCGCCGTGCAGGACGCCGCCAACAGCGGTA
TGCCGCCGCCGGGCGGAGAAGCCATCAGCCGCTTACAGGCGAGCGCCGGGCGTCTGCCGGGTGGGCTGCA
AAATATGTTCAGCCGCATGGCGGTCGGGGCGAGCAGCGACACCCAGCAGCGTGAGCTGGAAAACGTCCGC
AAGCGTATCAGCGTGGAAGTCGGCAGCTTCTGCCGCCAGGCGATCGCCGGCCGTTATCCGCTGGTGCGCT
CCGCCAGCAGCGAAGTGACGCCGGACGATCTGGCGCGCATGTTCGCGCCGGGCACTGGGCTGATGGACAG
TTTCTTTCGCGATAACCTGACGAATAAAGTCGATACCACCCAGCAGCGCTGGCGCTTTACGCCGGGCATC
GACGGCAAAACGCTGCCGGGCAGCGAAGGGGTGCTGCGTCCGTTCCAGCAGGCGCAATACATTCGCGACG
CCTTCTTCGCCAACGGCGCGACCACGCCGTCGTATCGCGTGACGGTGCGCACCGTGCGGATGGATAACGA
CATTCTCACGCTGTCGCTCGACGTTGACGGCCAGCTTCTGCGTTACAGCCACGGCCCGCAGGCGGTGCAG
CTGATGAGCTGGCCGGGCAGCGGCGGCACCAATCAGGTGCGTATGCAGCTCGGGCTTGCCAACGGCACCA
CCTCGACGCTGGTGACCAACGGCGCGTGGGCGCTGAACCGCTTTTTCGATCGCGCCCGCATTGCGCCGGG
TGCAGGAAGCCTGAGCCGCCAGGCGACGTTTTCGGTTGACGGACACAGCGTGACGCTGGAATTCACGCCG
AACAGTATCCGCAACCCATTCCAGCTCCCTGGCTTCGCATGCCCTTAA
 Primer design