SecReT6
Protein ID: 568128405
SecReT6 ID884
T6SS typei4b
Gene symbol-
Locus tagAX27061_3290
StrainAchromobacter xylosoxidans NBRC 15126 = ATCC 27061
Repliconchromosome [GenBank: NC_023061] [Browse all T6SS(s) in this replicon]
Location [Strand]3618168..3621974 [+]
ProductIcmF-related protein
NoteTssM
UniProt IDV9RY79
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.90E-73, Aligned region: 201..461
IcmF-related [PF06761], Evalue: 4.20E-53, Aligned region: 506..854
DUF1215 [PF06744], Evalue: 1.00E-28, Aligned region: 79..118
DUF1215 [PF06744], Evalue: 1.00E-28, Aligned region: 801..814
DUF1215 [PF06744], Evalue: 1.00E-28, Aligned region: 981..1099
Protein Sequence: 1268 a.a.     [Download]
>gi|568128405|ref|YP_008925052.1| IcmF-related protein [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
MRSPSGFFSGISSALSEGRHWTSRALGNPRLFMAIGLIALVVFLFLFADTVEIGLAWAGIALGIFLLLWL
CAYLWRRRRARRANKNLGDMLEQQVQTGSAAANRGDVDALRTRLVQAVRTIKTSKIGQVSGNEALYELPW
YIVIGNPAAGKSSAVINSGLQFPFADKNGAAVRGVGGTRNCDWFFTTEGILLDTAGRYSVHEEDRNEWMG
FLDLLKRHRPKAPINGIIVAASIDELTGAGPEFAINLAKNLRQRVQELTDRLEVFAPVYIIFTKADLISG
FSEFFSDSDQRERDRVWGATLPYGAEENRDVLALFDERFDELYEGLKEMGTAQISLRNNRELPPGLLTFP
LEFAGIKPALRTFLSTLFETNPFQYKPVFRGFYFTSALQEGVSQSTSTERLAERFDLRPAARGQARNVSS
HNGFFLRDLFSSVIFADKTLVRQHASPAKTRMRYLTFFGLVLALGLVLGGWSWSYLGNRQLAQNVQADLD
KVVRLQSERTDLQSRLEAMEILQDRIEQLDRYSSSRPWSLGLGLYQGDVLKERLLAEYYNGARQFMLSPV
KASLEDFLAKVDMSGAAAAAGGAQQPAPQAVRASHVPGGDTLFQDASPTNADDAYNALKTYLMMANRQHV
DPTHLSDQITRFWRGWLETNRGAMPRDQLIRSAERLISFYVSRAPDAGWPQIDTNLALVEKTRASLRAVM
QGMPARERAYATLKARAATRFQTMTVARIVGENDAGVVAGSYAIPGTFTREAWEQYIQPAINEAAKKEVQ
TSDWVLGVNARDDLTLDGSPEQIQKSLATMYKTEYAQEWQKFLRGVTIKPFTSFEQSVGAMNRLGDPQTS
PIAKLINTAYEQTSWDNPSLVNAGLQQAQSGVVGWFKRVILRQTPPAPTPATTANGEAIPMGPVGREFSD
VARLVVTRENQSLLGNYMGALSKIRTRFNLLNNQGDPGPGSLVLLRQTLEGKDSELADALKLVDEQMLAG
LSATQRETLRPLLVRPLIQAYAVAMQPAERELNKVWNAQIYQPFNQTLAEKYPFAARASVEASSDEIGQV
FGPQGSIAKYVNDTLGPLTVRRGDILTARTWGDMGISLQPTFTANFAQWVAPLSGGAGAGSASQPQTLFQ
IQPKPAAGVTEYTIEIDGQQLRYRNTPPQWVNFVWPNAQGAPGARITATTFDGSVVEIVNEPGRFGLERL
IATAQRTANADGSFNMSWGKSNVTVPVKLRIISNAQAPGAGGSEPGGSQGLRNLRLPSSVVGASPESSSA
QTRPGAPQ
 
Nucleotide Sequence: 3807 bp     [Download]
>gi|568125122|ref|NC_023061.1|:3618168-3621974 Achromobacter xylosoxidans NBRC 15126 = ATCC 27061, complete genome
ATGCGTAGCCCTTCAGGTTTCTTTTCCGGTATCTCCAGCGCCCTGAGCGAAGGTCGCCATTGGACCTCCC
GCGCCCTCGGCAATCCGCGCCTGTTCATGGCGATCGGCCTGATCGCCCTGGTCGTGTTCCTGTTCCTGTT
TGCCGACACCGTCGAGATCGGCCTGGCCTGGGCCGGCATCGCGCTGGGAATATTCCTGTTGCTCTGGCTG
TGCGCCTATCTGTGGCGCCGGCGCCGCGCGCGCCGCGCCAACAAGAACCTGGGCGACATGCTGGAGCAGC
AGGTGCAGACGGGCAGCGCGGCCGCCAATCGCGGGGACGTGGACGCGCTGCGCACGCGCCTGGTGCAGGC
GGTGCGCACCATCAAGACGTCCAAGATCGGCCAGGTGTCGGGCAACGAAGCGCTGTACGAACTGCCCTGG
TACATCGTGATCGGCAACCCCGCCGCGGGCAAGAGCAGCGCGGTGATCAATTCCGGCCTGCAATTCCCCT
TCGCCGACAAGAACGGCGCGGCGGTGCGCGGCGTGGGCGGCACCCGCAACTGCGACTGGTTCTTCACCAC
CGAAGGCATCCTGCTGGACACGGCCGGCCGCTACTCGGTGCACGAGGAAGACCGCAATGAATGGATGGGT
TTTCTCGACCTGCTCAAGCGTCATCGCCCCAAGGCGCCGATCAACGGCATCATCGTGGCCGCCAGCATCG
ACGAGCTGACCGGCGCCGGGCCGGAATTCGCCATCAACCTGGCCAAGAACCTGCGCCAGCGCGTGCAGGA
ACTGACCGACCGGCTGGAAGTGTTCGCGCCGGTCTACATCATCTTCACCAAGGCCGACCTGATCTCGGGC
TTCAGCGAATTCTTCTCCGACAGCGACCAGCGCGAGCGCGACCGCGTCTGGGGCGCCACCCTGCCCTACG
GCGCGGAAGAGAACCGCGACGTGCTGGCCCTGTTCGACGAACGCTTCGATGAACTGTACGAAGGCCTCAA
GGAAATGGGCACGGCGCAGATCTCGCTGCGCAACAACCGCGAACTGCCGCCGGGACTGCTGACCTTCCCG
CTGGAGTTCGCCGGCATCAAGCCGGCGCTGCGCACCTTCCTGTCGACGCTGTTCGAGACCAACCCGTTCC
AGTACAAGCCCGTGTTCCGCGGCTTCTACTTCACCAGCGCGCTGCAGGAAGGCGTGTCGCAAAGCACCTC
GACCGAACGGCTGGCCGAACGCTTCGACCTGCGCCCGGCCGCCCGCGGCCAGGCGCGCAACGTGTCCTCG
CACAACGGCTTCTTCCTGCGCGACCTGTTCTCCAGCGTGATCTTCGCCGACAAGACGCTGGTGCGCCAGC
ACGCCAGCCCGGCCAAGACCCGCATGCGCTACCTGACCTTCTTCGGCCTGGTGCTGGCGCTGGGCCTGGT
GCTGGGCGGCTGGAGCTGGTCGTACCTGGGCAACCGCCAGCTGGCGCAGAACGTGCAGGCCGACCTGGAC
AAGGTGGTGCGCCTGCAAAGCGAGCGCACCGACCTGCAGAGCCGCCTGGAGGCCATGGAGATCCTGCAGG
ACCGCATCGAGCAGCTGGACCGCTATTCGTCCAGCCGCCCGTGGTCGCTGGGCCTGGGCCTGTACCAGGG
CGACGTGCTCAAGGAGCGCCTGCTGGCCGAGTACTACAACGGCGCGCGCCAGTTCATGCTGAGCCCGGTC
AAGGCCAGCCTGGAGGACTTCCTGGCCAAGGTCGACATGTCCGGCGCCGCGGCGGCGGCCGGCGGCGCGC
AGCAGCCGGCGCCGCAGGCGGTGCGCGCCTCGCACGTCCCGGGCGGCGACACGCTGTTCCAGGATGCCTC
GCCGACCAATGCCGACGACGCCTACAACGCGCTCAAGACGTACCTGATGATGGCCAATCGCCAGCACGTC
GACCCCACCCACCTGTCCGACCAGATCACGCGTTTCTGGCGCGGCTGGCTGGAGACCAACCGCGGCGCCA
TGCCGCGCGACCAGCTGATTCGCAGCGCCGAACGCCTGATCTCGTTCTACGTCAGCCGCGCGCCCGACGC
CGGCTGGCCGCAGATCGACACCAACCTGGCGCTGGTGGAAAAGACCCGCGCCAGCCTGCGCGCCGTGATG
CAGGGCATGCCGGCGCGCGAACGCGCCTACGCCACGCTCAAGGCGCGCGCCGCCACGCGCTTCCAGACCA
TGACGGTGGCGCGCATCGTCGGCGAGAACGACGCCGGCGTGGTGGCCGGCAGCTACGCCATCCCCGGCAC
CTTCACCCGCGAGGCCTGGGAGCAGTACATCCAGCCCGCCATCAACGAGGCCGCCAAGAAGGAAGTGCAG
ACCAGCGACTGGGTGCTGGGCGTGAACGCGCGCGACGACCTGACGCTGGACGGCAGCCCCGAGCAGATCC
AGAAGAGCCTGGCGACGATGTACAAGACGGAGTACGCCCAGGAATGGCAGAAGTTCCTGCGCGGCGTGAC
CATCAAGCCCTTCACCAGCTTCGAGCAGTCGGTGGGCGCGATGAACCGCCTGGGCGACCCGCAGACCTCG
CCCATCGCCAAGCTCATCAACACCGCCTACGAACAGACCTCGTGGGACAACCCGTCGCTGGTCAACGCCG
GTCTGCAACAGGCGCAGAGCGGCGTGGTCGGCTGGTTCAAGCGCGTGATCCTGCGGCAGACGCCGCCCGC
GCCCACGCCCGCCACCACCGCCAACGGCGAAGCCATTCCGATGGGTCCGGTGGGCCGCGAGTTCTCGGAC
GTGGCGCGCCTGGTGGTGACGCGCGAGAACCAGTCGCTGCTGGGTAACTACATGGGCGCGCTGTCCAAGA
TCCGCACGCGCTTCAACCTGCTCAACAACCAGGGCGACCCCGGCCCCGGCTCGCTGGTGCTGCTGCGCCA
GACGCTGGAGGGCAAGGATTCGGAGCTGGCCGACGCGCTCAAGCTGGTCGACGAGCAGATGCTGGCCGGC
CTGTCGGCGACGCAGCGCGAAACGCTGCGTCCGCTGCTGGTGCGGCCGCTGATCCAGGCCTACGCCGTGG
CCATGCAACCGGCCGAACGCGAACTGAACAAGGTCTGGAACGCGCAGATCTACCAGCCCTTCAACCAGAC
CCTGGCCGAGAAGTACCCGTTCGCCGCGCGCGCCAGCGTCGAGGCCAGCAGCGACGAGATCGGCCAGGTG
TTCGGTCCGCAGGGCAGCATCGCCAAGTACGTCAACGACACCCTCGGCCCGCTGACCGTGCGCCGCGGCG
ACATCCTGACGGCGCGCACCTGGGGCGACATGGGCATCAGCCTGCAGCCGACCTTCACCGCCAACTTCGC
GCAGTGGGTGGCGCCGCTGTCCGGCGGCGCGGGCGCCGGTTCGGCCAGCCAGCCGCAGACGCTGTTCCAG
ATCCAGCCCAAGCCCGCCGCCGGGGTGACCGAATACACCATCGAGATCGACGGCCAGCAGCTGCGCTACC
GCAACACGCCGCCGCAATGGGTCAACTTCGTCTGGCCCAACGCCCAGGGCGCGCCCGGCGCGCGCATTAC
CGCCACCACCTTCGACGGCAGCGTGGTCGAGATCGTCAACGAACCGGGACGCTTCGGCCTGGAGCGCCTG
ATCGCGACCGCCCAGCGCACCGCCAACGCCGACGGCAGCTTCAACATGAGCTGGGGCAAGTCCAACGTGA
CGGTGCCGGTCAAGCTGCGCATCATCAGCAACGCCCAGGCGCCCGGCGCCGGCGGCAGCGAGCCCGGCGG
CAGCCAGGGCCTGCGCAACCTGCGCCTGCCCTCCTCCGTGGTGGGCGCATCCCCCGAATCCTCCTCCGCC
CAGACGCGACCCGGAGCGCCGCAATGA
 Primer design